Atlas of Genetics and Cytogenetics in Oncology and Haematology


Home   Genes   Leukemias   Solid Tumors   Cancer-Prone   Deep Insight   Case Reports   Journals  Portal   Teaching   

X Y 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 NA

t(6;11)(q27;q23) KMT2A/AFDN

Written1997-11Jean-Loup Huret
Genetics, Dept Medical Information, University of Poitiers, CHU Poitiers Hospital, F-86021 Poitiers, France
Updated2017-07Jean-Loup Huret
Genetics, Dept Medical Information, University of Poitiers, CHU Poitiers Hospital, F-86021 Poitiers, France

Abstract Review on the t(6;11)(q27;q23) involving KMT2A (better known as MLL), and AFDN (Afadin), also known as AF6 or MLLT4. It occurs in acute myeloid leukemia, at times treatment-related leukemia, B lymphoblastic leukemia, and T-cell lymphoblastic leukemia. It carries a poor prognosis.

Keywords Chromosome 6; chromosome 11; t(6;11)(q27;q23); KMT2A; MLL; AFDN; Afadin; AF6; MLLT4; acute myeloid leukemia; treatment-related leukemia; B lymphoblastic leukemia; T-cell lymphoblastic leukemia.

(Note : for Links provided by Atlas : click)

Identity

ICD-Topo C420,C421,C424
ICD-Morpho 9861/3 AML with mutated NPM1; AML with mutated CEBPA; Acute myeloid leukaemia, NOS
ICD-Morpho 9920/3 Therapy-related myeloid neoplasms
ICD-Morpho 9807/3 Mixed phenotype acute leukaemia with t(v;11q23); MLL rearranged
ICD-Morpho 9813/3 B lymphoblastic leukaemia/lymphoma with t(v;11q23); MLL rearranged
ICD-Morpho 9837/3 T lymphoblastic leukaemia/lymphoma
Atlas_Id 1015
Note Herein below, the well-known term "MLL" will be used, instead of the poorly known term "KMT2A"
A total of 135 different MLL rearrangements have been identified so far (Meyer et al., 2017).
Other namest(6;11)(q27;q23) MLL/MLLT4
t(6;11)(q27;q23) MLL/AF6
 
  t(6;11)(q27;q23) G- banding - Courtesy Diane H. Norback, Eric B. Johnson, Sara Morrison-Delap Cytogenetics at theWaisman Center (left and middle), and Jean-Luc Lai (right).

Clinics and Pathology

Note The incidence of 11q23 abnormalities in infants with acute lymphoblastic leukemia (ALL) ranges from 60% to 80%., and from 4.5% to 5.7% among children who are older than 1 year and have ALL. The t(4;11)(q21;q23) MLL / AFF1, one of the most common 11q23 abnormalities, occurs in 2% of children and adults with ALL (Raimondi 2004).
The incidence of 11q23 abnormalities in children with acute myeloid leukemia (AML) ranges from 15% to 25%. In children younger than 2 years, the peak incidence of 11q23/MLL gene rearrangements is 50%-60%.
The incidence of 11q23 abnormalities in adults with AML is approximately 5% (Coenen et al., 2012).
The incidence of 11q23 abnormalities among adult ALL cases is about 10% (Pui et al., 2004).
Disease Translocation t(6;11) represent about 5% of acute leukemia with 11q23/MLL rearrangement and is more frequent in AML than in ALL. Different studies are available, each involving specific groups of patients, and they cannot be pooled in one meta-analysis:
In a large study on 2,345 acute leukemia patients with 11q23/MLL rearrangement, there were 1,420 patients diagnosed with ALL (61%), 872 diagnosed with AML (37%) and 7 with MDS; 38 were mixed lineage leukemia (1.6%), 4 lymphomas, and 4 other. Of these 2,345 patients with MLL rearrangements, there was 95 cases of t(6;11). They represented 4% of the cases. Of these 95 cases, there were 26 ALL, 68 AML, and 1 "other"; two of them were 2 treatment related leukemia. Translocation t(6;11) was found in 7.8% of AML with MLL rearrangements and 1.8% of ALL with MLL rearrangements. There were 59 cases of T-cell ALL in this series of 2,345 acute leukemia patients. T-ALL was mainly composed of AFDN (AF6, MLLT4) and MLLT1 (ENL) gene fusions: there were 23 AFDN (AF6, MLLT4) cases and 22 MLLT1 (ENL) cases (Meyer et al., 2017).
In a series of 550 cases with an 11q23 rearrangement, 30 cases (5.5%) were shown to have a t(6;11)(q27;q23) There were 27 AMLs (26 de novo and 1 secondary, 3 M1, 2 M2, 8 M4, 1 M4/5, 13 M5) and 3 infant/childhood ALL, 1 being a T-ALL (Martineau et al., 1998).
In a study of 756 childhood AML with 11q23 rearrangement, 35 (5%) showed a t(6;11). The disease was an AML-M1 in 15%, AML-M2 in 6%, AML-M4 in 35%, AML-M5 in 41% (Balgobind et al., 2009).
In a study of 415 adult AML cases (389 de novo and 26 treatment-related AML), 54 were rearranged for MLL (31 MLL-fusions and 23 MLL partial tandem duplications (PTD)), 8 of which (26% of 11q23 rearrangements, 1,9% of adult AML cases) were t(6;11) cases. There was 2 AML-M1, 1 AML-M2, 2 AML-M4, 3 AML-M5 (Lavallee et al 2015). 11q23 rearrangements were identified in 118 adult AML cases (85 de novo and 33 t-AML). A t(6;11) (n=17) was found in 14% of 11q23 rearrangements (Grossmann). Out of 2667 adults with de novo AML, 16 patients (0.6%) were identified with t(6;11). there was 3 M1, 7 M4, 5 M5 (Blum et al., 2004).
Epidemiology In the large study of 2,345 acute leukemia patients with 11q23-MLL-rearrangement, there was 876 infants, 671 "pediatric" cases (infants excluded), and 798 adults. Of the the 95 cases with t(6;11) in this study, median age was 19 years, with 3 infant, 44 pediatric, and 48 adult cases; this abnormality is rare in infants (0,3%) and more frequent in children and adults: 6,6 and 6% respectively. Sex ratio was 45M/50F. Mean age of T-cell ALL cases with t(6;11) was 17 years, with 14 pediatric and 9 adult cases. Sex ratio was 11M/12F (Meyer et al., 2017). In another study of t(6;11)(q27;q23) acute leukemia, median age was 30-35 years (range 0.5-72, with 2 infant cases and 6 other children under 16). Sex ratio was 17M/13F (57%) (Martineau et al., 1998).
In a study of 35 childhood AMLs, median age 12 years (8% were infant cases, 34% were aged 2-9 yrs, and 57% were older children). M/F was 19/16 (54%) (Balgobind et al., 2009).
On 8 adult AML cases : age were 22-58 years, and sex ratio was 3M/5F (Lavallee et al 2015). Median age of adults with de novo AML was 45 years (range 22-65) in another study and sex ratio was 7M/8F (Blum et al., 2004).
Clinics Central nervous system involvement was found in 15% of 35 cases of childhood 11q23/MLL-rearranged acute myeloid leukemia (Balgobind et al., 2009)
Prognosis Complete remission (CR) was obtained in 23 of 26 AML cases, but median survival was only 12 months (Martineau et al., 1998). The 35 patients with a t(6;11)(q27;q23) had the worst outcome compared to other childhood 11q23/MLL-rearranged acute myeloid leukemia groups: 5-year event free survival (EFS) was 11% (± 5%) and 5-year overall survival (OS) was 22% (Balgobind et al., 2009). CR was achieved in 69% of adults with de novo AML (11 of 16 patients), but CR duration was short (median 9 months). The estimated probability of 2-year survival was 13%. Both long-term survivors received allogeneic stem cell transplantation. The estimated probability of 2-year survival of patients reported in the literature was 15% (Blum et al., 2004). However, as there are many progresses in therapy, one cannot rely on survival studies made 10 or 20 years ago.

Cytogenetics

Cytogenetics Morphological In a series of 30 cases with t(6;11)(q27;q23), (27 AMLs and 3 ALLs). The t(6;11) was the sole abnormality in 24 cases (at least in a subclone), +der(6)t(6;11), +8, +19 and +21 were found in 10% (3 times) each. All three patients with AML-M1 had additional abnormalities. (Martineau et al., 1998). In a series of adults with de novo AML, the t(6;11) was the sole abnormality in 12/15 cases; der(6)t(6;11) and +8 were found in one case each (Blum et al., 2004)
Cytogenetics Molecular The t(6;11) translocation can escape recognition: chromosome 6 involvement may be overlooked and the abnormality may be missinterpreted as a del(11q), with conventional banding techniques; FISH techniques necessary.

Genes involved and Proteins

Note Frequent KRAS and NRAS mutations were found (30% and 18% respectively) in AML adult cases and there was MECOM overexpression in 100% (Grossmann et al., 2013).There was high expression levels of NKX2-3 and MECOM in AML adult cases. (Lavallee et al 2015). Methylation of lysine79 of histone H3 (H3K79) is a prerequisite for maintenance of RNA transcription. MLL/AFF1 (AF4), MLL/ MLLT3 (AF9), MLL/MLLT1 (ENL), MLL/MLLT10 (AF10) and MLL/AFDN (AF6, MLLT4), result in an increased and extended H3K79 methylation (Meyer et al., 2017).
Gene NameKMT2A
Location 11q23.3
Note Better known as MLL
Dna / Rna 37 exons, spanning about 120 kb; 13-15 mRNA
Protein 3969 amino acids, 431 kDa; Transcriptional regulatory factor. MLL is known to be associated with more than 30 proteins, including the core components of the SWI/SNF chromatin remodeling complex and the transcription complex TFIID. MLL binds promotors of HOX genes through acetylation and methylation of histones. MLL is a major regulator of hematopoesis and embryonic development, through regulation of HOX genes expression regulation (HOXA9 in particular).
Gene NameAFDN
Location 6q27
Note AFDN was previously called MLLT4 (myeloid/lymphoid or mixed-lineage leukemia; translocated to, 4) or AF6 (ALL1 fused gene from chromosome 6)
Protein The protein, called afadin, is a scaffolding protein with a role in cell-cell junctional complexes (adherens junctions and in tight junctions). The transmembrane proteins cadherins and nectins interact with other proteins through their cytoplasmic domain to form adherens junctions. CTNNA1, CTNNA2 or CTNNA3 (α-catenins) /CTNNB1 (β-catenin) links cadherins to the actin cytoskeleton and afadin links nectins to the actin cytoskeleton (Boettner et al., 2000; Tachibana et al., 2000; Bégay-Müller et al., 2002). Afadin plays an essential role in regulating apical-basal polarity and adherens junction integrity (Rakotomamonjy et al., 2017).
Loss of expression or lower expression of afadin is found in pancreatic cancer, and is correlated with poor prognosis in colon cancer and breast cancer, induces cell migration and cell invasion of myometrium in endometrial cancer, where it is associated with high histological grades (Fournier et al., 2011; Sun et al., 2014; Xu et al., 2015; Yamamoto et al., 2015a).

Result of the chromosomal anomaly

Hybrid gene
Description The breakpoint in AFDN (AF6, MLLT4) was determined from two AML, one T-ALL, and one cell line. It was found between exons 1 and 2, corresponding to the junction of amino acid 35 and 36 (Tanabe et al., 1996); i.e.
MSAGGRDEERRKLADIIHHWNANRLDLFEISQPTE/DLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQD
In 8 of 8 AML adult cases, MLL exon/intron 8 was fused to AFDN (AF6, MLLT4) exon/intron 1 (Lavallee et al 2015).
In the large study of 95 cases of acute leukemia with t(6;11); the breakpoint in MLL was more often in intron 9 (65% on cases) than it was in other fusions (e.g. AFF1 (AF4): 33%, MLLT3 (AF9): 38%, MLLT1 (ENL): 23%, where intron 11 is equally or more frequent). The breakpoint was in: intron 9: 62 cases, exon 10: 4 cases, intron 10: 15 cases, exon 11: 4 cases, intron 11: 3 cases, exon 12: 2 cases. Only in MLL/AFDN cases were observed very unusual MLL breakpoints (n=4), within intron 21 and 23. The authors pointed out that "This is quite important because such a far away downstream breakpoint includes the complete PHD1-3, the BD domain as well as the complete ePHD4 domain of MLL into the fusion protein with AFDN (AF6, MLLT4). These additional 581 amino acids could be an important hint for the importance of these MLL domains in T-ALL. The PHD1-3 and bromodomain exert important regulatory functions to the MLL N-terminus, like chromatin reading, protein stability or PPIE (CYP33) binding. In the latter case, binding of the BMI1 repressor complex will reverse the function of the MLL/AFDN fusion by repressing gene transcription" (Meyer et al., 2017).
  
Fusion Protein
 
  t(6;11)(q27;q23) MLL/AFDN
Oncogenesis While AFDN localizes in the cytoplasm, MLL/AFDN localizes in the nucleus, leading to aberrant activation of RAS and of its downstream targets (Deshpande et al., 2013; Manara et al. 2014).
  

Bibliography

The LIM domain protein Lmo2 binds to AF6, a translocation partner of the MLL oncogene
Bégay-Müller V, Ansieau S, Leutz A
FEBS Lett 2002 Jun 19;521(1-3):36-8
PMID 12067721
 
Novel prognostic subgroups in childhood 11q23/MLL-rearranged acute myeloid leukemia: results of an international retrospective study
Balgobind BV, Raimondi SC, Harbott J, Zimmermann M, Alonzo TA, Auvrignon A, Beverloo HB, Chang M, Creutzig U, Dworzak MN, Forestier E, Gibson B, Hasle H, Harrison CJ, Heerema NA, Kaspers GJ, Leszl A, Litvinko N, Nigro LL, Morimoto A, Perot C, Pieters R, Reinhardt D, Rubnitz JE, Smith FO, Stary J, Stasevich I, Strehl S, Taga T, Tomizawa D, Webb D, Zemanova Z, Zwaan CM, van den Heuvel-Eibrink MM
Blood 2009 Sep 17;114(12):2489-96
PMID 19528532
 
Adult de novo acute myeloid leukemia with t(6;11)(q27;q23): results from Cancer and Leukemia Group B Study 8461 and review of the literature
Blum W, Mrózek K, Ruppert AS, Carroll AJ, Rao KW, Pettenati MJ, Anastasi J, Larson RA, Bloomfield CD
Cancer 2004 Sep 15;101(6):1420-7
PMID 15368330
 
The junctional multidomain protein AF-6 is a binding partner of the Rap1A GTPase and associates with the actin cytoskeletal regulator profilin
Boettner B, Govek EE, Cross J, Van Aelst L
Proc Natl Acad Sci U S A 2000 Aug 1;97(16):9064-9
PMID 10922060
 
11q23 rearrangements in de novo childhood acute myeloid leukemia
Coenen EA, Harbott J, Zwaan CM, Raimondi SC, van den Heuvel-Eibrink MM
Atlas Genet Cytogenet Oncol Haematol. 2012;16(8):574-581.
 
Leukemic transformation by the MLL-AF6 fusion oncogene requires the H3K79 methyltransferase Dot1l
Deshpande AJ, Chen L, Fazio M, Sinha AU, Bernt KM, Banka D, Dias S, Chang J, Olhava EJ, Daigle SR, Richon VM, Pollock RM, Armstrong SA
Blood 2013 Mar 28;121(13):2533-41
PMID 23361907
 
Loss of AF6/afadin, a marker of poor outcome in breast cancer, induces cell migration, invasiveness and tumor growth
Fournier G, Cabaud O, Josselin E, Chaix A, Adélaïde J, Isnardon D, Restouin A, Castellano R, Dubreuil P, Chaffanet M, Birnbaum D, Lopez M
Oncogene 2011 Sep 8;30(36):3862-74
PMID 21478912
 
High incidence of RAS signalling pathway mutations in MLL-rearranged acute myeloid leukemia
Grossmann V, Schnittger S, Poetzinger F, Kohlmann A, Stiel A, Eder C, Fasan A, Kern W, Haferlach T, Haferlach C
Leukemia 2013 Sep;27(9):1933-6
PMID 23535558
 
The transcriptomic landscape and directed chemical interrogation of MLL-rearranged acute myeloid leukemias
Lavallée VP, Baccelli I, Krosl J, Wilhelm B, Barabé F, Gendron P, Boucher G, Lemieux S, Marinier A, Meloche S, Hébert J, Sauvageau G
Nat Genet 2015 Sep;47(9):1030-7
PMID 26237430
 
MLL-AF6 fusion oncogene sequesters AF6 into the nucleus to trigger RAS activation in myeloid leukemia
Manara E, Baron E, Tregnago C, Aveic S, Bisio V, Bresolin S, Masetti R, Locatelli F, Basso G, Pigazzi M
Blood 2014 Jul 10;124(2):263-72
PMID 24695851
 
The t(6;11)(q27;q23) translocation in acute leukemia: a laboratory and clinical study of 30 cases
Martineau M, Berger R, Lillington DM, Moorman AV, Secker-Walker LM
EU Concerted Action 11q23 Workshop participants Leukemia
PMID 9593282
 
The MLL recombinome of acute leukemias in 2017
Meyer C, Burmeister T, Gröger D, Tsaur G, Fechina L, Renneville A, Sutton R, Venn NC, Emerenciano M, Pombo-de-Oliveira MS, Barbieri Blunck C, Almeida Lopes B, Zuna J, Trka J, Ballerini P, Lapillonne H, De Braekeleer M, Cazzaniga G, Corral Abascal L, van der Velden VHJ, Delabesse E, Park TS, Oh SH, Silva MLM, Lund-Aho T, Juvonen V, Moore AS, Heidenreich O, Vormoor J, Zerkalenkova E, Olshanskaya Y, Bueno C, Menendez P, Teigler-Schlegel A, Zur Stadt U, Lentes J, Göhring G, Kustanovich A, Aleinikova O, Schäfer BW, Kubetzko S, Madsen HO, Gruhn B, Duarte X, Gameiro P, Lippert E, Bidet A, Cayuela JM, Clappier E, Alonso CN, Zwaan CM, van den Heuvel-Eibrink MM, Izraeli S, Trakhtenbrot L, Archer P, Hancock J, Möricke A, Alten J, Schrappe M, Stanulla M, Strehl S, Attarbaschi A, Dworzak M, Haas OA, Panzer-Grümayer R, Sedék L, Szczepański T, Caye A, Suarez L, Cavé H, Marschalek R
Leukemia 2017 Jul 13
PMID 28701730
 
Acute lymphoblastic leukemia
Pui CH, Relling MV, Downing JR
N Engl J Med 2004 Apr 8;350(15):1535-48
PMID 15071128
 
11q23 rearrangements in childhood acute lymphoblastic leukemia
Raimondi, SC
Atlas Genet Cytogenet Oncol Haematol. 2004;8(2):97-102.
 
Afadin controls cell polarization and mitotic spindle orientation in developing cortical radial glia
Rakotomamonjy J, Brunner M, Jüschke C, Zang K, Huang EJ, Reichardt LF, Chenn A
Neural Dev 2017 May 8;12(1):7
PMID 28482867
 
Disrupted interaction between CFTR and AF-6/afadin aggravates malignant phenotypes of colon cancer
Sun TT, Wang Y, Cheng H, Xiao HZ, Xiang JJ, Zhang JT, Yu SB, Martin TA, Ye L, Tsang LL, Jiang WG, Xiaohua J, Chan HC
Biochim Biophys Acta 2014 Mar;1843(3):618-28
PMID 24373847
 
Two cell adhesion molecules, nectin and cadherin, interact through their cytoplasmic domain-associated proteins
Tachibana K, Nakanishi H, Mandai K, Ozaki K, Ikeda W, Yamamoto Y, Nagafuchi A, Tsukita S, Takai Y
J Cell Biol 2000 Sep 4;150(5):1161-76
PMID 10974003
 
Analysis of the t(6;11)(q27;q23) in leukemia shows a consistent breakpoint in AF6 in three patients and in the ML-2 cell line
Tanabe S, Zeleznik-Le NJ, Kobayashi H, Vignon C, Espinosa R 3rd, LeBeau MM, Thirman MJ, Rowley JD
Genes Chromosomes Cancer 1996 Apr;15(4):206-16
PMID 8703846
 
Loss of polarity protein AF6 promotes pancreatic cancer metastasis by inducing Snail expression
Xu Y, Chang R, Peng Z, Wang Y, Ji W, Guo J, Song L, Dai C, Wei W, Wu Y, Wan X, Shao C, Zhan L
Nat Commun 2015 May 26;6:7184
PMID 26013125
 
Loss of AF-6/afadin induces cell invasion, suppresses the formation of glandular structures and might be a predictive marker of resistance to chemotherapy in endometrial cancer
Yamamoto T, Mori T, Sawada M, Matsushima H, Ito F, Akiyama M, Kitawaki J
BMC Cancer 2015 Apr 12;15:275
PMID 25879875
 

Citation

This paper should be referenced as such :
Huret JL
t(6;11)(q27;q23) KMT2A/AFDN;
Atlas Genet Cytogenet Oncol Haematol. in press
On line version : http://AtlasGeneticsOncology.org/Anomalies/t0611ID1015.html
History of this paper:
Huret, JL. t(6;11)(q27;q23). Atlas Genet Cytogenet Oncol Haematol. 1997;1(2):87-88.
http://documents.irevues.inist.fr/bitstream/handle/2042/32066/11-1997-t0611ID1015.pdf


Other genes implicated (Data extracted from papers in the Atlas) [ 2 ]

Genes AFDN KMT2A

Translocations implicated (Data extracted from papers in the Atlas)

 t(6;11)(q27;q23) KMT2A/AFDN

External links

KMT2A (11q23.3) MLLT4 (6q27)

KMT2A (11q23.3) MLLT4 (6q27)

Mitelman databaset(6;11)(q27;q23) [Case List]    t(6;11)(q27;q23) [Association List] Mitelman database (CGAP - NCBI)
arrayMapMorph ( 9861/3) - arrayMap (UZH-SIB Zurich)  [auto + random 100 samples .. if exist ]   [tabulated segments]
arrayMapMorph ( 9920/3) - arrayMap (UZH-SIB Zurich)  [auto + random 100 samples .. if exist ]   [tabulated segments]
arrayMapMorph ( 9807/3) - arrayMap (UZH-SIB Zurich)  [auto + random 100 samples .. if exist ]   [tabulated segments]
arrayMapMorph ( 9813/3) - arrayMap (UZH-SIB Zurich)  [auto + random 100 samples .. if exist ]   [tabulated segments]
arrayMapMorph ( 9837/3) - arrayMap (UZH-SIB Zurich)  [auto + random 100 samples .. if exist ]   [tabulated segments]
 
COSMIC_fusionKMT2A/MLLT4 KMT2A (11q23.3) MLLT4 (6q27)   [fusion1806]   [fusion1807]   [fusion1808]   [fusion1810]   [fusion1811]   [fusion1812]   [fusion1826]   [fusion2009]   [fusion2010]   [fusion2012]   [fusion2013]   [fusion2014]  
TICdbKMT2A/MLLT4  KMT2A (11q23.3) MLLT4 (6q27)
 
Disease databaset(6;11)(q27;q23) KMT2A/AFDN
REVIEW articlesautomatic search in PubMed
Last year articlesautomatic search in PubMed
All articlesautomatic search in PubMed


© Atlas of Genetics and Cytogenetics in Oncology and Haematology
indexed on : Tue Nov 21 15:09:35 CET 2017


Home   Genes   Leukemias   Solid Tumors   Cancer-Prone   Deep Insight   Case Reports   Journals  Portal   Teaching   

For comments and suggestions or contributions, please contact us

jlhuret@AtlasGeneticsOncology.org.