Atlas of Genetics and Cytogenetics in Oncology and Haematology

Home   Genes   Leukemias   Solid Tumors   Cancer-Prone   Deep Insight   Case Reports   Journals  Portal   Teaching   

X Y 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 NA

TMSB10 (thymosin beta 10)

Written2010-03Xueshan Qiu
Department of Pathology, the First Affiliated Hospital and College of Basic Medical Sciences of China Medical University, Shenyang, China
Updated2014-12Xueshan Qiu, Yumei Gu
Department of Pathology, the First Affiliated Hospital and College of Basic Medical Sciences of China Medical University, Shenyang, China

Abstract TMSB10 (thymosin beta 10) is a member of the beta-thymosin family, which is an actin-sequestering protein involved in cell motility. The expression of TMSB10 is associated with the development of several tissues. In many kind of human cancers, TMSB10 expression is aberrant. TMSB10 may be correlated with tumor cells proliferation, apoptosis, metastasis and angiogenesis, and predict poor prognosis of some tumors.

Keywords TMSB 10, development, apoptosis, angiogenesis, cancer

(Note : for Links provided by Atlas : click)


Alias_symbol (synonym)TB10
Other aliasMIG12
HGNC (Hugo) TMSB10
LocusID (NCBI) 9168
Atlas_Id 42595
Location 2p11.2  [Link to chromosome band 2p11]
Location_base_pair Starts at 84905639 and ends at 84906675 bp from pter ( according to hg19-Feb_2009)  [Mapping TMSB10.png]
Fusion genes
(updated 2017)
Data from Atlas, Mitelman, Cosmic Fusion, Fusion Cancer, TCGA fusion databases with official HUGO symbols (see references in chromosomal bands)
ICAM1 (19p13.2) / TMSB10 (2p11.2)TMSB10 (2p11.2) / AGAP1 (2q37.2)TMSB10 (2p11.2) / CD63 (12q13.2)
TMSB10 (2p11.2) / RPS16 (19q13.2)
Note TMSB10 is a member of the beta-thymosin family, which is an actin-sequestering protein involved in cell motility. TMSB10 may be correlated with tumor cells proliferation, apoptosis, metastasis and angiogenesis.


Description The cDNA sequence for human TMSB10 is 482 nucleotides long comprising 3 exons. The open reading frame of the coding region is 135 bp.


Description Protein length (NP_066926.1): 44 amino acids. (madkpdmgeiasfdkaklkktetqekntlptketieqekrseis)
Molecular weight: 4.9 kDa.
TMSB10 is a small G-actin binding protein, and it induces depolymerization of intracellular F-actin pools by sequestering actin monomers.
Expression TMSB10 is found in human, rat, mouse, cat, and rabbit. TMSB10 is one of the most abundant beta-thymosins.
Localisation TMSB10 is expressed in cytoplasm.
Function Overview: TMSB10 is a highly conserved small acid protein. It is present in many tissues and cell types. It can sequester actin monomers and bind to G-actin in a 1:1 complex.

Actin monomer sequestering protein: TMSB10 is one of G-actin binding proteins, being expressed in all mammalian species. It can sequester monomeric actin and inhibit actin polymerization. It participates in the regulation of cancer cell motility (Erickson-Viitanen S et al., 1983; Abiko T et al., 1986; Goodall GJ et al., 1987; McCreary V et al.,1988; Nachmias VT,1993; Yu FX et al.,1993; Yu FX et al.,1994; Huff T et al.,1997; Vassiliadou I,1999; Liu CR et al.,2004; Mu H et al.,2006).

Development: The expression of TMSB10 is associated with the development of several tissues. It is involved in the development of the oral cavity and its annexes and developing salivary gland and kidney. TMSB10 may be have multiple functions in the developmental course from initiation to root formation of the tooth germ.. TMSB10 plays an important role in early neuroembryogenesis. It is present in the developing nervous, and has a specific physiological function during cerebellum development. TMSB10 is only present at very low levels in a very small subpopulation of glia in the adult cerebellum. In young animals, most of the TMSB10 is localized in granule cells, Golgi neurons and Purkinje cells. In old animals, TMSB10 signal is detected faintly in a few Purkinje cells(Hall AK et al.,1990; Lin SC et al.,1990; Hall AK,1991; Hall AK et al.,1991; Lin SC et al.,1991; Lugo DI et al., Condon MR et al.,1992; Border BG et al., 1993; Voisin PJ et al., 1995; Carpintero P et al.,1996 ;Carpintero P et al.,1999; Anadon R et al.,2001; Bani-Yaghoub M et al.,2001; Gomez-Marquez J et al.,2002;T okuriki M et al.,2003; Nemolato S et al.,2009; Gerosa C et al.,2010; Fanni D et al.,2011; Shiotsuka M et al.,2013).

Apoptosis: TMSB10 regulates apoptosis. For example, upregulation of TMSB10 in M. bovis-infected macrophages is linked with increased cell death due to apoptosis. TMSB10 can disrupt F-actin stress fibers, markedly decrease ovarian cancer cells growth, and a high rate of apoptosis. TMSB10 plays a significant role in cell apoptosis possibly by acting as an actin-mediated tumor suppressor, perhaps functions as a neoapoptotic influence during embryogenesis, and may mediate some of the pro-apoptotic anticancer actions of retinoids(Hall AK,1995; Gutierrez-Pabello JA et al.,2002; Rho SB et al.,2004; Lee SH et al.,2005; Rho SB et al.,2005)..

Angiogenesis: TMSB10 may be an effective inhibitor of angiogenesis by inhibiting endothelial migration, tube formation, VEGF, VEGFR-1 and integrin alphaV expression in HCAECs. TMSB10 is not only a cytoskeletal regulator, it also acts as a potent inhibitor of angiogenesis and tumor growth by interaction with Ras (Koutrafouri V et al.,2001; Vasile E et al.,2001; Zhang Y et al.,2009).

Cancers: Elevated expression of TMSB10 is associated with invasion and metastasis of several kinds of tumors. It may be considered a potential tool for the diagnosis of several human neoplasias. TMSB10 is detected mainly in the malignant tissue, particularly in the cancerous cells, whereas the normal cell population around the lesions showed very weak staining. Also, the intensity of staining in the cancerous cells is proportionally increased with the increasing grade of the lesions(Santelli G et al.,1999; Sribenja S et al., 2009; Sribenja S et al.,2013).

Homology Homolog to thymosin beta 4 and thymosin beta 15.

Implicated in

Entity Pancreatic cancer
Note TSMB10 is expressed in human pancreatic carcinoma, but not in non-neoplastic pancreatic tissue, suggesting a role for TMSB10 in the carcinogenesis of pancreatic carcinoma. It is a promising marker and a novel therapeutic target for pancreatic cancer. Exogenous TMSB10 causes the phosphorylation of JNK and increases the secretion of cytokines interleukin (IL)-7 and IL-8 in BxPC-3 pancreatic cancer cells (Alldinger I et al., 2005; Li M et al.,2009).
Entity Non-small cell lung cancer
Note TMSB10 might induce microvascular and lymphatic vessel formation by up-regulating vascular endothelial growth factor and vascular endothelial growth factor-C in lung cancer tissues, thus promoting the distant and lymph node metastases and being implicated in the progression of non-small cell lung cancer. TMSB10 hypomethylation may be frequently in NSCLCs, but it may not be a common mechanism of TMSB10 overexpression (Gu Y et al., 2009; Lee SM et al., 2011).
Entity Breast cancer
Note TMSB10 plays a key role in sequestration of G-actin as well as in breast cancer cell motility (Verghese-Nikolakaki S et al., 1996; Otto AM et al., 2002; Maelan AE et al., 2007).
Entity Ovarian cancer
Note TMSB10 inhibits angiogenesis and tumor growth by interfering Ras signal transduction and expression of VEGF. TMSB10 decreased mitochondrial membrane potential and increased reactive oxygen species (ROS) production of human ovarian cancer cells. Also these findings indicate that upregulation of ROS production due to TMSB10 overexpression increases ovarian cancer cells apoptosis (Lee SH et al., 2001; Kim YC et al., 2012).
Entity Thyroid neoplasias
Note TMSB10 overexpression is a general event of thyroid cell neoplastic transformation. An increased expression of TMSB10 mRNA in thyroid carcinomas is found. The evaluation of TMSB10 gene expression may be considered a promising means of human thyroid hyperproliferative diagnosis. By decreasing TMSB10 expression, the thyroid cancer cells growth in soft agar is inhibited. . In papillary thyroid neoplasias, high expressions of TMSB10 mRNA and protein are more common in patients with cervical lymph node metastases (LNM) and central neck LNM (Califano D et al., 1998; Viglietto G et al., 1999; Santelli G et al., 2002; Takano T et al., 2002; Chiappetta G et al., 2004; Feher LZ et al., 2012; Zhang XJ et al., 2014).
Entity Renal cell carcinoma
Note The TMSB10 gene is deregulated in renal cell carcinoma and it may be a new molecular marker for renal-cell carcinoma (Ren Fail, 1994).
Entity Cutaneous melanoma
Note TMSB10 can be considered as a new progression marker for human cutaneous melanoma (Weterman MA et al., 1993).
Entity Hepato cellular carcinoma
Note The expression levels of TMSB10 mRNA and protein are significantly higher in hepatocellular carcinoma tissues than those in matched non-tumorous tissues. High expression of TMSB10 is significantly associated with advanced TNM stage and poorer survival in hepatocellular carcinoma patients (Wang H et al., 2014).
Entity Cholangiocarcinoma
Note Low expression of TMSB10 is associated with metastasis of cholangiocarcinoma in vitro and in vivo. TMSB10 expression may be mediated by the activation of Ras, ERK1/2. TMSB10 can upregulates Snail andmatrix metalloproteinases (MMPs) expressions (Sribenja S et al., 2013).
Entity Cervical cancer
Note TMSB10 gene can predict pelvic lymph node metastasis (PLNM) in patients with early cervical carcinoma (Huang L et al., 2011).


Synthesis of deacetyl-thymosin beta 10 and examination of its immunological effect on T-cell subpopulations of a uremic patient with tuberculosis.
Abiko T, Sekino H.
Chem Pharm Bull (Tokyo). 1986 Nov;34(11):4708-17.
PMID 3493851
Gene expression analysis of pancreatic cell lines reveals genes overexpressed in pancreatic cancer.
Alldinger I, Dittert D, Peiper M, Fusco A, Chiappetta G, Staub E, Lohr M, Jesnowski R, Baretton G, Ockert D, Saeger HD, Grutzmann R, Pilarsky C.
Pancreatology. 2005;5(4-5):370-9. Epub 2005 Jun 23.
PMID 15983444
Differential expression of thymosins beta(4) and beta(10) during rat cerebellum postnatal development.
Anadon R, Rodriguez Moldes I, Carpintero P, Evangelatos G, Livianou E, Leondiadis L, Quintela I, Cervino MC, Gomez-Marquez J.
Brain Res. 2001 Mar 16;894(2):255-65.
PMID 11251199
Array analysis of the genes regulated during neuronal differentiation of human embryonal cells.
Bani-Yaghoub M, Felker JM, Ozog MA, Bechberger JF, Naus CC.
Biochem Cell Biol. 2001;79(4):387-98.
PMID 11527208
Alterations in actin-binding beta-thymosin expression accompany neuronal differentiation and migration in rat cerebellum.
Border BG, Lin SC, Griffin WS, Pardue S, Morrison-Bogorad M.
J Neurochem. 1993 Dec;61(6):2104-14.
PMID 8245965
Thymosin beta-10 gene overexpression correlated with the highly malignant neoplastic phenotype of transformed thyroid cells in vivo and in vitro.
Califano D, Monaco C, Santelli G, Giuliano A, Veronese ML, Berlingieri MT, de Franciscis V, Berger N, Trapasso F, Santoro M, Viglietto G, Fusco A.
Cancer Res. 1998 Feb 15;58(4):823-8.
PMID 9485041
Expression of the thymosin beta10 gene in normal and kainic acid-treated rat forebrain.
Carpintero P, Anadon R, Gomez-Marquez J.
Brain Res Mol Brain Res. 1999 Jun 18;70(1):141-6.
PMID 10381552
Thymosin beta-10 gene expression as a possible tool in diagnosis of thyroid neoplasias.
Chiappetta G, Pentimalli F, Monaco M, Fedele M, Pasquinelli R, Pierantoni GM, Ribecco MT, Santelli G, Califano D, Pezzullo L, Fusco A.
Oncol Rep. 2004 Aug;12(2):239-43.
PMID 15254683
Expression of thymosin beta-4 and related genes in developing human brain.
Condon MR, Hall AK.
J Mol Neurosci. 1992;3(3):165-70.
PMID 1627460
Thymosin beta 10, a new analog of thymosin beta 4 in mammalian tissues.
Erickson-Viitanen S, Ruggieri S, Natalini P, Horecker BL.
Arch Biochem Biophys. 1983 Sep;225(2):407-13.
PMID 6578703
Thymosin beta 10 expression in developing human salivary glands.
Fanni D, Gerosa C, Nemolato S, Locci A, Marinelli V, Cabras T, Messana I, Fanos V, Castagnola M, Faa G.
Early Hum Dev. 2011;87(12):779-83.
PMID 21733645
Amplification of thymosin beta 10 and AKAP13 genes in metastatic and aggressive papillary thyroid carcinomas.
Fehér LZ, Pocsay G, Krenács L, Zvara A, Bagdi E, Pocsay R, Lukács G, Gy?ry F, Gazdag A, Tarkó E, Puskás LG.
Pathol Oncol Res. 2012;18(2):449-58.
PMID 22161024
Thymosin beta-10 expression in developing human kidney.
Gerosa C, Fanni D, Nemolato S, Locci A, Marinelli V, Cabras T, Messana I, Castagnola M, Monga G, Fanos V, Faa G.
J Matern Fetal Neonatal Med. 2010;23 Suppl 3:125-8.
PMID 20836742
The beta-thymosins, small actin-binding peptides widely expressed in the developing and adult cerebellum.
Gomez-Marquez J, Anadon R.
Cerebellum. 2002 Apr;1(2):95-102. (REVIEW)
PMID 12882358
Molecular cloning of the cDNA for rat spleen thymosin beta 10 and the deduced amino acid sequence.
Goodall GJ, Horecker BL.
Arch Biochem Biophys. 1987 Jul;256(1):402-5.
PMID 3606131
Expression of thymosin beta10 and its role in non-small cell lung cancer.
Gu Y, Wang C, Wang Y, Qiu X, Wang E.
Hum Pathol. 2009 Jan;40(1):117-24. Epub 2008 Sep 11.
PMID 18789485
Upregulation of thymosin beta-10 by Mycobacterium bovis infection of bovine macrophages is associated with apoptosis.
Gutierrez-Pabello JA, McMurray DN, Adams LG.
Infect Immun. 2002 Apr;70(4):2121-7.
PMID 11895978
Retinoic acid regulates thymosin beta 10 levels in rat neuroblastoma cells.
Hall AK, Chen SC, Hempstead JL, Morgan JI.
J Neurochem. 1991 Feb;56(2):462-8.
PMID 1846397
Thymosin beta 10 levels in developing human brain and its regulation by retinoic acid in the HTB-10 neuroblastoma.
Hall AK, Hempstead J, Morgan JI.
Brain Res Mol Brain Res. 1990 Jul;8(2):129-35.
PMID 2169566
Thymosin beta-10 accelerates apoptosis.
Hall AK.
Cell Mol Biol Res. 1995;41(3):167-80.
PMID 8589757
Identification of a gene-expression signature for predicting lymph node metastasis in patients with early stage cervical carcinoma.
Huang L, Zheng M, Zhou QM, Zhang MY, Jia WH, Yun JP, Wang HY.
Cancer. 2011 Aug;117(15):3363-73. doi: 10.1002/cncr.25870. Epub 2011 Feb 11.
PMID 21319141
C-terminal truncation of thymosin beta10 by an intracellular protease and its influence on the interaction with G-actin studied by ultrafiltration.
Huff T, Muller CS, Hannappel E.
FEBS Lett. 1997 Sep 1;414(1):39-44.
PMID 9305728
Thymosin ?10 expression driven by the human TERT promoter induces ovarian cancer-specific apoptosis through ROS production.
Kim YC, Kim BG, Lee JH.
PLoS One. 2012;7(5):e35399.
PMID 22623951
Effect of thymosin peptides on the chick chorioallantoic membrane angiogenesis model.
Koutrafouri V, Leondiadis L, Avgoustakis K, Livaniou E, Czarnecki J, Ithakissios DS, Evangelatos GP.
Biochim Biophys Acta. 2001 Nov 7;1568(1):60-6.
PMID 11731086
Thymosin {beta}(10) inhibits angiogenesis and tumor growth by interfering with Ras function.
Lee SH, Son MJ, Oh SH, Rho SB, Park K, Kim YJ, Park MS, Lee JH.
Cancer Res. 2005 Jan 1;65(1):137-48.
PMID 15665289
Overexpression of the thymosin beta-10 gene in human ovarian cancer cells disrupts F-actin stress fiber and leads to apoptosis.
Lee SH, Zhang W, Choi JJ, Cho YS, Oh SH, Kim JW, Hu L, Xu J, Liu J, Lee JH.
Oncogene. 2001 Oct 11;20(46):6700-6.
PMID 11709704
Hypomethylation of the thymosin ?(10) gene is not associated with its overexpression in non-small cell lung cancer.
Lee SM, Na YK, Hong HS, Jang EJ, Yoon GS, Park JY, Kim DS.
Mol Cells. 2011;32(4):343-8.
PMID 22038593
Thymosin beta-10 is aberrantly expressed in pancreatic cancer and induces JNK activation.
Li M, Zhang Y, Zhai Q, Feurino LW, Fisher WE, Chen C, Yao Q.
Cancer Invest. 2009 Mar;27(3):251-6.
PMID 19194824
Cloning and characterization of a testis-specific thymosin beta 10 cDNA. Expression in post-meiotic male germ cells.
Lin SC, Morrison-Bogorad M.
J Biol Chem. 1991 Dec 5;266(34):23347-53.
PMID 1744129
Differential thymosin beta 10 expression levels and actin filament organization in tumor cell lines with different metastatic potential.
Liu CR, Ma CS, Ning JY, You JF, Liao SL, Zheng J.
Chin Med J (Engl). 2004 Feb;117(2):213-8.
PMID 14975205
Developmental regulation of beta-thymosins in the rat central nervous system.
Lugo DI, Chen SC, Hall AK, Ziai R, Hempstead JL, Morgan JI.
J Neurochem. 1991 Feb;56(2):457-61.
PMID 1988550
Localization of thymosin beta10 in breast cancer cells: relationship to actin cytoskeletal remodeling and cell motility.
Maelan AE, Rasmussen TK, Larsson LI.
Histochem Cell Biol. 2007 Jan;127(1):109-13. Epub 2006 Jun 20.
PMID 16786322
Sequence of a human kidney cDNA clone encoding thymosin beta 10.
McCreary V, Kartha S, Bell GI, Toback FG.
Biochem Biophys Res Commun. 1988 Apr 29;152(2):862-6.
PMID 3365256
Thymosin beta10 inhibits cell migration and capillary-like tube formation of human coronary artery endothelial cells.
Mu H, Ohashi R, Yang H, Wang X, Li M, Lin P, Yao Q, Chen C.
Cell Motil Cytoskeleton. 2006 Apr;63(4):222-30.
PMID 16496302
Small actin-binding proteins: the beta-thymosin family.
Nachmias VT.
Curr Opin Cell Biol. 1993 Feb;5(1):56-62. (REVIEW)
PMID 8448031
Thymosin beta(4) and beta(10) levels in pre-term newborn oral cavity and foetal salivary glands evidence a switch of secretion during foetal development.
Nemolato S, Messana I, Cabras T, Manconi B, Inzitari R, Fanali C, Vento G, Tirone C, Romagnoli C, Riva A, Fanni D, Di Felice E, Faa G, Castagnola M.
PLoS One. 2009;4(4):e5109. Epub 2009 Apr 1.
PMID 19337364
Chemotherapeutic drugs change actin skeleton organization and the expression of beta-thymosins in human breast cancer cells.
Otto AM, Muller CS, Huff T, Hannappel E.
J Cancer Res Clin Oncol. 2002 May;128(5):247-56. Epub 2002 Mar 19.
PMID 12029440
The interaction between E-tropomodulin and thymosin beta-10 rescues tumor cells from thymosin beta-10 mediated apoptosis by restoring actin architecture.
Rho SB, Chun T, Lee SH, Park K, Lee JH.
FEBS Lett. 2004 Jan 16;557(1-3):57-63.
PMID 14741341
The identification of apoptosis-related residues in human thymosin beta-10 by mutational analysis and computational modeling.
Rho SB, Lee KW, Chun T, Lee SH, Park K, Lee JH.
J Biol Chem. 2005 Oct 7;280(40):34003-7. Epub 2005 Jul 12.
PMID 16012174
Thymosin beta-10 protein synthesis suppression reduces the growth of human thyroid carcinoma cells in semisolid medium.
Santelli G, Bartoli PC, Giuliano A, Porcellini A, Mineo A, Barone MV, Busiello I, Trapasso F, Califano D, Fusco A.
Thyroid. 2002 Sep;12(9):765-72.
PMID 12481941
The expression and function of thymosin beta 10 in tooth germ development.
Shiotsuka M, Wada H, Kiyoshima T, Nagata K, Fujiwara H, Kihara M, Hasegawa K, Someya H, Takahashi I, Sakai H.
Int J Dev Biol. 2013;57(11-12):873-83.
PMID 24623079
Suppression of thymosin ?10 increases cell migration and metastasis of cholangiocarcinoma.
Sribenja S, Sawanyawisuth K, Kraiklang R, Wongkham C, Vaeteewoottacharn K, Obchoei S, Yao Q, Wongkham S, Chen C.
BMC Cancer. 2013;13:430.
PMID 24053380
Quantitative analysis of thymosin beta-10 messenger RNA in thyroid carcinomas.
Takano T, Hasegawa Y, Miyauchi A, Matsuzuka F, Yoshida H, Kuma K, Amino N.
Jpn J Clin Oncol. 2002 Jul;32(7):229-32.
PMID 12324571
Gene expression analysis of human middle ear cholesteatoma using complementary DNA arrays.
Tokuriki M, Noda I, Saito T, Narita N, Sunaga H, Tsuzuki H, Ohtsubo T, Fujieda S, Saito H.
Laryngoscope. 2003 May;113(5):808-14.
PMID 12792315
Differential expression of thymosin beta-10 by early passage and senescent vascular endothelium is modulated by VPF/VEGF: evidence for senescent endothelial cells in vivo at sites of atherosclerosis.
Vasile E, Tomita Y, Brown LF, Kocher O, Dvorak HF.
FASEB J. 2001 Feb;15(2):458-66.
PMID 11156961
Investigation of the epitopic structure of thymosin beta10 by epitope mapping experiments.
Vassiliadou I, Leondiadis L, Ferderigos N, Ithakissios DS, Evangelatos GP, Livaniou E.
Peptides. 1999;20(3):411-4.
PMID 10447102
Preliminary findings on the expression of thymosin beta-10 in human breast cancer.
Verghese-Nikolakaki S, Apostolikas N, Livaniou E, Ithakissios DS, Evangelatos GP.
Br J Cancer. 1996 Nov;74(9):1441-4.
PMID 8912542
Regulation of thymosin beta10 expression by TSH and other mitogenic signals in the thyroid gland and in cultured thyrocytes.
Viglietto G, Califano D, Bruni P, Baldassarre G, Vento MT, Belletti B, Fedele M, Santelli G, Boccia A, Manzo G, Santoro M, Fusco A.
Eur J Endocrinol. 1999 Jun;140(6):597-607.
PMID 10366416
Developmental characterization of thymosin beta 4 and beta 10 expression in enriched neuronal cultures from rat cerebella.
Voisin PJ, Pardue S, Morrison-Bogorad M.
J Neurochem. 1995 Jan;64(1):109-20.
PMID 7798904
High expression of thymosin beta 10 predicts poor prognosis for hepatocellular carcinoma after hepatectomy.
Wang H, Jiang S, Zhang Y, Pan K, Xia J, Chen M.
World J Surg Oncol. 2014; 12:226.
PMID 25037578
Thymosin beta-10 expression in melanoma cell lines and melanocytic lesions: a new progression marker for human cutaneous melanoma.
Weterman MA, van Muijen GN, Ruiter DJ, Bloemers HP.
Int J Cancer. 1993 Jan 21;53(2):278-84.
PMID 8425765
Effects of thymosin beta 4 and thymosin beta 10 on actin structures in living cells.
Yu FX, Lin SC, Morrison-Bogorad M, Yin HL.
Cell Motil Cytoskeleton. 1994;27(1):13-25.
PMID 8194107
Overexpression of thymosin beta-10 inhibits VEGF mRNA expression, autocrine VEGF protein production, and tube formation in hypoxia-induced monkey choroid-retinal endothelial cells.
Zhang T, Li X, Yu W, Yan Z, Zou H, He X.
Ophthalmic Res. 2009;41(1):36-43. Epub 2008 Oct 16.
PMID 18854659
Thymosin beta 10 correlates with lymph node metastases of papillary thyroid carcinoma.
Zhang XJ, Su YR, Liu D, Xu DB, Zeng MS, Chen WK.
J Surg Res. 2014 May 27. [Epub ahead of print]
PMID 24974154


This paper should be referenced as such :
Qiu X, Gu Y
TMSB10 (thymosin beta 10);
Atlas Genet Cytogenet Oncol Haematol. in press
On line version :
History of this paper:
Qiu, X. TMSB10 (thymosin beta 10). Atlas Genet Cytogenet Oncol Haematol. 2010;14(12):1166-1169.

Other Solid tumors implicated (Data extracted from papers in the Atlas) [ 2 ]
  t(2;12)(p11;q13) TMSB10/CD63
t(2;19)(p11;q13) TMSB10/RPS16

External links

HGNC (Hugo)TMSB10   11879
Entrez_Gene (NCBI)TMSB10  9168  thymosin beta 10
AliasesMIG12; TB10
GeneCards (Weizmann)TMSB10
Ensembl hg19 (Hinxton)ENSG00000034510 [Gene_View]
Ensembl hg38 (Hinxton)ENSG00000034510 [Gene_View]  ENSG00000034510 [Sequence]  chr2:84905639-84906675 [Contig_View]  TMSB10 [Vega]
ICGC DataPortalENSG00000034510
TCGA cBioPortalTMSB10
AceView (NCBI)TMSB10
Genatlas (Paris)TMSB10
SOURCE (Princeton)TMSB10
Genetics Home Reference (NIH)TMSB10
Genomic and cartography
GoldenPath hg38 (UCSC)TMSB10  -     chr2:84905639-84906675 +  2p11.2   [Description]    (hg38-Dec_2013)
GoldenPath hg19 (UCSC)TMSB10  -     2p11.2   [Description]    (hg19-Feb_2009)
EnsemblTMSB10 - 2p11.2 [CytoView hg19]  TMSB10 - 2p11.2 [CytoView hg38]
Mapping of homologs : NCBITMSB10 [Mapview hg19]  TMSB10 [Mapview hg38]
Gene and transcription
Genbank (Entrez)AF090913 AK130949 AK311952 AY453400 BC016025
RefSeq transcript (Entrez)NM_021103
RefSeq genomic (Entrez)
Consensus coding sequences : CCDS (NCBI)TMSB10
Cluster EST : UnigeneHs.612032 [ NCBI ]
CGAP (NCI)Hs.612032
Alternative Splicing GalleryENSG00000034510
Gene ExpressionTMSB10 [ NCBI-GEO ]   TMSB10 [ EBI - ARRAY_EXPRESS ]   TMSB10 [ SEEK ]   TMSB10 [ MEM ]
Gene Expression Viewer (FireBrowse)TMSB10 [ Firebrowse - Broad ]
SOURCE (Princeton)Expression in : [Datasets]   [Normal Tissue Atlas]  [carcinoma Classsification]  [NCI60]
GenevestigatorExpression in : [tissues]  [cell-lines]  [cancer]  [perturbations]  
BioGPS (Tissue expression)9168
GTEX Portal (Tissue expression)TMSB10
Human Protein AtlasENSG00000034510-TMSB10 [pathology]   [cell]   [tissue]
Protein : pattern, domain, 3D structure
UniProt/SwissProtP63313   [function]  [subcellular_location]  [family_and_domains]  [pathology_and_biotech]  [ptm_processing]  [expression]  [interaction]
NextProtP63313  [Sequence]  [Exons]  [Medical]  [Publications]
With graphics : InterProP63313
Splice isoforms : SwissVarP63313
Domaine pattern : Prosite (Expaxy)THYMOSIN_B4 (PS00500)   
Domains : Interpro (EBI)Beta-thymosin    Beta-thymosin_sf   
Domain families : Pfam (Sanger)Thymosin (PF01290)   
Domain families : Pfam (NCBI)pfam01290   
Domain families : Smart (EMBL)THY (SM00152)  
Domain structure : Prodom (Prabi Lyon)Thymosin_b4 (PD005116)   
Conserved Domain (NCBI)TMSB10
DMDM Disease mutations9168
Blocks (Seattle)TMSB10
Human Protein Atlas [tissue]ENSG00000034510-TMSB10 [tissue]
Peptide AtlasP63313
Protein Interaction databases
IntAct (EBI)P63313
Ontologies - Pathways
Ontology : AmiGOactin monomer binding  protein binding  cytoplasm  cytoskeleton  actin filament organization  regulation of cell migration  sequestering of actin monomers  
Ontology : EGO-EBIactin monomer binding  protein binding  cytoplasm  cytoskeleton  actin filament organization  regulation of cell migration  sequestering of actin monomers  
NDEx NetworkTMSB10
Atlas of Cancer Signalling NetworkTMSB10
Wikipedia pathwaysTMSB10
Orthology - Evolution
GeneTree (enSembl)ENSG00000034510
Phylogenetic Trees/Animal Genes : TreeFamTMSB10
Homologs : HomoloGeneTMSB10
Homology/Alignments : Family Browser (UCSC)TMSB10
Gene fusions - Rearrangements
Fusion : MitelmanTMSB10/CD63 [2p11.2/12q13.2]  
Fusion : MitelmanTMSB10/RPS16 [2p11.2/19q13.2]  [t(2;19)(p11;q13)]  
Fusion PortalTMSB10 2p11.2 CD63 12q13.2 PRAD
Fusion Cancer (Beijing)TMSB10 [2p11.2]  -  AGAP1 [2q37.2]  [FUSC000396]  [FUSC000396]
Fusion : QuiverTMSB10
Polymorphisms : SNP and Copy number variants
NCBI Variation ViewerTMSB10 [hg38]
dbSNP Single Nucleotide Polymorphism (NCBI)TMSB10
Exome Variant ServerTMSB10
ExAC (Exome Aggregation Consortium)ENSG00000034510
GNOMAD BrowserENSG00000034510
Varsome BrowserTMSB10
Genetic variants : HAPMAP9168
Genomic Variants (DGV)TMSB10 [DGVbeta]
DECIPHERTMSB10 [patients]   [syndromes]   [variants]   [genes]  
CONAN: Copy Number AnalysisTMSB10 
ICGC Data PortalTMSB10 
TCGA Data PortalTMSB10 
Broad Tumor PortalTMSB10
OASIS PortalTMSB10 [ Somatic mutations - Copy number]
Somatic Mutations in Cancer : COSMICTMSB10  [overview]  [genome browser]  [tissue]  [distribution]  
Mutations and Diseases : HGMDTMSB10
LOVD (Leiden Open Variation Database)Whole genome datasets
LOVD (Leiden Open Variation Database)LOVD 3.0 shared installation
BioMutasearch TMSB10
DgiDB (Drug Gene Interaction Database)TMSB10
DoCM (Curated mutations)TMSB10 (select the gene name)
CIViC (Clinical Interpretations of Variants in Cancer)TMSB10 (select a term)
NCG5 (London)TMSB10
Cancer3DTMSB10(select the gene name)
Impact of mutations[PolyPhen2] [Provean] [Buck Institute : MutDB] [Mutation Assessor] [Mutanalyser]
Genetic Testing Registry TMSB10
NextProtP63313 [Medical]
Target ValidationTMSB10
Huge Navigator TMSB10 [HugePedia]
snp3D : Map Gene to Disease9168
BioCentury BCIQTMSB10
Clinical trials, drugs, therapy
Chemical/Protein Interactions : CTD9168
Chemical/Pharm GKB GenePA36580
Clinical trialTMSB10
canSAR (ICR)TMSB10 (select the gene name)
PubMed46 Pubmed reference(s) in Entrez
GeneRIFsGene References Into Functions (Entrez)
REVIEW articlesautomatic search in PubMed
Last year publicationsautomatic search in PubMed

Search in all EBI   NCBI

© Atlas of Genetics and Cytogenetics in Oncology and Haematology
indexed on : Wed Nov 28 16:09:14 CET 2018

Home   Genes   Leukemias   Solid Tumors   Cancer-Prone   Deep Insight   Case Reports   Journals  Portal   Teaching   

For comments and suggestions or contributions, please contact us