ZMYND10 (zinc finger, MYND-type containing 10)

2014-07-01   Xiangning Zhang  , Michael I Lerman  , Zhiwei He  

Guangdong Medical College, Dongguan, Guangdong 523808, China (XZ, ZH); Affina Biotechnologies, Inc., Stamford, CT USA (MIL)

Identity

HGNC
LOCATION
3p21.31
LOCUSID
ALIAS
BLU,CILD22,DNAAF7,FLU

Abstract

The candidate tumor suppressor gene ZMYND10\/BLU, is located on the minimal deleted fragment of 110 kb in chromosomal region 3p21.3. It was initially identified by PCR in search of the b-catenin homolog in lung cancer. BLU codes for a protein with 440 amino acid residues, which contains a zinc finger myelogenous nervy domain (zMYND) motif on its carboxyl terminus. The characteristic domain defines a ZMYNND protein family, some of its member have been found in the frequently affected region translocated during acute leukemias, and were described to be transcriptional repressors. BLU\/ZMYND10 is inactivated in a variety of human tumors due to genetic or epigenetic mechanisms, but the function is largely unknown. It has been reported that similar with certain tumor suppressors, it donwregulates JNK\/MAPK signaling to exert inhibition on growth and proliferation. ZMYND10 is implicated in the respiratory ciliary dyskinesia.

DNA/RNA

Note

NM_015896, 4.7 kb.
Atlas Image
The gene of 4.5-4.7 kb contains 12 (lung version, termed as canonic) or 11 (testis version) exons coding for a 2-kb, alternatively spliced mRNA, well expressed in lung and testis but not expressed in all other tested human tissues.

Description

The genomic size of the gene is about 4.5 kb.

Transcription

The testis isoform contains 11 exons because of a complex selection of an alternative acceptor site.

Pseudogene

No known pseudogenes.

Proteins

Note

NP_056980; ZMYND10 (zinc finger, myeloid, nervy and DEAF-1 (MYND)-type containing 10).
Atlas Image
See below.

Description

The BLU protein is likely a soluble cytoplasmic protein and shares 30-32% identity over a stretch of 100-112 amino acids (residues 334-437 or 318-430) with proteins of the MTG/ETO family of transcription factors and the suppressins. The most notable feature of the protein is a C-terminal MYND domain, spanning residues 394-430. The MYND domain constitutes a protein-protein interaction surface that appears to allow these proteins to act as transcriptional co-repressors by association with a variety of chromatin remodelling and transcription.

Expression

Low level expression in most human tissues.

Localisation

A majority of its coding product is located in cytoplasma.

Function

The function of BLU/ZMYND10 is unknown. As a MYND-containing protein BLU/ZMYND10 is most likely to be involved in important transcriptional regulation pathways. It has been reported that BLU regulate cell cycle progression through inhibition JNK signaling.

Homology

Shares 30-32% identity over a stretch of 100-112 amino acids (residues 334-437 or 318-430) with proteins of the MTG/ETO family of transcription factors and the suppressins.

Mutations

Note

The lung isoform is regarded as canonic isoform. The testis-specific protein isoform contains a different amino acid sequence between residues 199 and 234 as compared with the canonic lung-specific isoform. Mutation of BLU/ZMYND10 within a given isoform is a rare event in lung cancer and other cancers since missense changes were detected in only 3/61 lung tumour-cell lines. The eight-gene set in the 120-kb region show that the mutation rate was in the range of 5%. Missense mutations were discovered in a sample of 61 lung cancer cell lines. It has been shown that, however, mutated ZMYND10 protein carrying substitution of some amino acid residues binds LRRC6 and contributes to pathogenesis of primary ciliary dyskinesia (PCD, or CILD22).

Somatic

Mutation carried by testis isoform 200-234: SLSLSTLSRMLSTHNLPCLLVELLEHSPWSRREGG → RQWSVSQPPQLAHLKRIQRLHPVCWFLSPG; results in the loss of one of three PKC phosphorylation sites (residues 229-231). The substitutions documented in PCD include: ZMYND10, VAL16GLY, SER29PRO, LEU39PRO, LEU266PRO, ARG369TRP, Tyr379CYS, and ASP198GLN, ARG407GLU in non-small cell lung cancer cells.

Implicated in

Entity name
Various cancers
Note
The gene codes for the putative tumor suppressor BLU is primarily expressed in the lung and testis, as tissue-specific isoforms, but the level is low in other tissues. The expression is varied in lung cancer cells, but a non-small lung cancer line, A549 has high level of BLU. A majority of nasopharyngeal carcinoma-derived cell lines, however, has downregulated expression of BLU. Mutation of the gene is relatively rare. Hypermethylation on BLU promoter has been detected ranging from 19% of primary non-small cell lung cancer to 66-74% of nasopharyngeal carcinoma (NPC).
Disease
Mutated BLU/ZMYND10 protein with several amino acid residues substitution has been shown to associate with LRRC6, and plays a role in the pathogenesis of primary ciliary dyskinesia. Hypermethylation and downregulation has been described as a frequent event in primary tumours such as glioma (80%), cervical squamous cell carcinomas (77%), NPC (66%), neuroblastoma (41-70%) and NSCLC (19-43%) with lower frequencies observed in gallbladder carcinomas (26%), ependymomas (13.6%) and SCLC (14%). It has been noted that in some tumors like glioma, methylation of BLU is an early detectable event; it was identified in stage II glioma and stage I/II cervical squamous cell carcinomas.
Cytogenetics
Unlike t(8;21) translocation frequently seen in acute myelogenous leukemia, involving ZMYND motif containing MTG8, no cytogenetic anomaly affecting BLU has been observed in malignancies.
Hybrid gene
No fusion gene(s) involving BLU has been reported.
Entity name
Lung cancer
Note
BLU is primarily expressed in lung and testis, with different isoforms. The mutation is rare. The expression is absent in a number of lung cancer cell lines, and in 19-43% of non-small lung cancer (NSLC) cases, BLU is silenced due to promoter hypermethylation (Agathanggelou et al., 2003; Marsit et al., 2005). The incidence is higher in adenocarcinoma (AC) than in squamous cell carcinoma (SCC). Frequent methylation for BLU and RASSF1 has been observed but there is no significant association. In lung cancer patients, homozygous deletion of 3p21 region has been association with early age of cigarette smoking initiation.
Entity name
Nasopharyngeal carcinoma (NPC)
Note
Downregulation of BLU expression was well correlated with the promoter hypermethylation in tumor specimens and cultured cell lines. Methylation on BLU promoter was identified in up to 66% of the tumors, and 6 out 7 passaged cell lines. BLU was observed to inhibit JNK signaling pathway, and cyclin D1 (CCND1) gene promoter activity, arrest cell cycle at G1 phase, and block in vitro and in vivo NPC cell growth.
Entity name
Glioma
Note
BLU/ZMYND10 hypermethylation and downregulation has been described as a frequent event in up to 80% primary tumours of glioma. BLU/ZMYND10 methylation is an early event detectable in stage II glioma (Hesson et al., 2004). In glioma tumours methylation of BLU/ZMYND10 and/or RASSF1A, located adjacent to BLU/ZMYND10, was detected in more than 95% (52/54) primary tumours.
Entity name
Neuroblastoma
Note
Methylation leading to downregulation of BLU has been described in up to 70% neuroblastoma (41-70%) (Abe et al., 2005). It was shown that methylation of promoter CGIs of RASSF1A (3p21) and BLU (3p21) was far more frequently observed in neuroblastomas with CpG island methylator phenotype (CIMP).
Entity name
Esophageal cancer
Note
In esophageal squamous cell carcinoma (ESCC), BLU expression was downregulated in three out of four Asian esophageal carcinoma cell lines, and 4 out of 8 pairs of tumor and normal tissues. Methylation specific-PCR revealed the down-regulation of BLU by epigenetic inactivation. However, exogenous expression of BLU did not functionally suppress tumorigenicity in nude mice. These results suggest that over-expression of BLU alone is not sufficient to inhibit tumorigenicity. (Yi Lo et al., 2006).
Entity name
Ovarian carcinoma
Note
Epithelial ovarian carcinoma is usually present at the advanced stage, during which the patients generally have poor prognosis. Our study aimed to evaluate the correlation of gene methylation and the clinical outcome of patients with advanced-stage, high-grade ovarian serous carcinoma. The methylation status of eight candidate genes was first evaluated by methylation-specific PCR and capillary electrophoresis to select three potential genes including DAPK, CDH1, and BLU (ZMYND10) from the exercise group of 40 patients. The methylation status of these three genes was further investigated in the validation group consisting of 136 patients. Patients with methylated BLU had significantly shorter progression-free survival (PFS; hazard ratio (HR) 1.48, 95% CI 1.01-2.56, P=0.013) and overall survival (OS; HR 1.83, 95% CI 1.07-3.11, P=0.027) in the multivariate analysis. Methylation of BLU was also an independent risk factor for 58 patients undergoing optimal debulking surgery for PFS (HR 2.37, 95% CI 1.03-5.42, P=0.043) and OS (HR 3.96, 95% CI 1.45-10.81, P=0.007) in the multivariate analysis. A possible mechanism of BLU in chemoresistance was investigated in ovarian cancer cell lines by in vitro apoptotic assays. In vitro studies have shown that BLU could upregulate the expression of BAX and enhance the effect of paclitaxel-induced apoptosis in ovarian cancer cells. Our study suggested that methylation of BLU could be a potential prognostic biomarker for advanced ovarian serous carcinoma.
Prognosis
Its correlation with prognosis of serous ovarian carcinoma has been documented. The methylation status of eight candidate genes, including BLU was first evaluated by methylation-specific PCR and capillary electrophoresis from tumor tissues of ovarian carcinoma in a group of patients. Patients with methylated BLU had significantly shorter progression-free survival and overall survival in the multivariate analysis (Chiang et al., 2013).
Entity name
Myelodysplastic syndrome (MDS)
Note
Hypermethylation in the promoter region and downregulation at mRNA and protein levels of BLU was detected in 34 of 79 (43%) MDS patient samples. There was a statistically significant difference in methylation frequency between different refractory anemia groups. The demethylating agent decitabine could partly reverse hypermethylation and restore the expression of the BLU gene. BLU promoter hypermethylation frequently occurs in higher risk MDS cases. BLU may play a role in the development and etiology of MDS.
Entity name
Primary ciliary dyskinesia (PCD)
Note
ZMYND10 bound to LRRC6 in HEK293T and in human tracheal epithelial cells. These two proteins localized to both the basal body and the striated rootlet in Xenopus ciliated epithelial cells. The C-terminal MYND domain of ZMYND10 was insufficient for interaction with the CS domain of LRRC6; but a C-terminal fragment expanding 366-440 amino acids extending beyond the MYND domain was necessary for interaction (see the scheme of protein diagram). Similar studies using progressive truncating constructs of LRRC6 confirmed that the C-terminal CS domain of LRRC6 is sufficient for the binding with ZMYND10. The protein-protein interaction is abrogated by truncating mutations in either gene in patients with CILD.

Article Bibliography

Pubmed IDLast YearTitleAuthors
157058802005CpG island methylator phenotype is a strong determinant of poor prognosis in neuroblastomas.Abe M et al
126295212003Epigenetic inactivation of the candidate 3p21.3 suppressor gene BLU in human cancers.Agathanggelou A et al
223608562012Tumor suppressor genes on frequently deleted chromosome 3p in nasopharyngeal carcinoma.Chen J et al
233296492013Epigenetic silencing of BLU through interfering apoptosis results in chemoresistance and poor prognosis of ovarian serous carcinoma patients.Chiang YC et al
147432092004Frequent epigenetic inactivation of RASSF1A and BLU genes located within the critical 3p21.3 region in gliomas.Hesson L et al
119806732002Expression of several genes in the human chromosome 3p21.3 homozygous deletion region by an adenovirus vector results in tumor suppressor activities in vitro and in vivo.Ji L et al
94170891998Molecular cloning, sequence analysis, expression, and tissue distribution of suppressin, a novel suppressor of cell cycle entry.LeBoeuf RD et al
110855362000The 630-kb lung cancer homozygous deletion region on human chromosome 3p21.3: identification and evaluation of the resident candidate tumor suppressor genes. The International Lung Cancer Chromosome 3p21.3 Tumor Suppressor Gene Consortium.Lerman MI et al
127947572003Alterations of BLU, a candidate tumor suppressor gene on chromosome 3p21.3, in human nasopharyngeal carcinoma.Liu XQ et al
155402102005Hypermethylation of RASSF1A and BLU tumor suppressor genes in non-small cell lung cancer: implications for tobacco smoking during adolescence.Marsit CJ et al
236284172013Tumor suppressor BLU promotes paclitaxel antitumor activity by inducing apoptosis through the down-regulation of Bcl-2 expression in tumorigenesis.Park ST et al
151223372004The candidate tumor suppressor gene BLU, located at the commonly deleted region 3p21.3, is an E2F-regulated, stress-responsive gene and inactivated by both epigenetic and genetic mechanisms in nasopharyngeal carcinoma.Qiu GH et al
170849652007Frequent epigenetic inactivation of chromosome 3p candidate tumor suppressor genes in gallbladder carcinoma.Riquelme E et al
96616691998Structure and expression of the human MTG8/ETO gene.Wolford JK et al
222462782012Tumor suppressor gene BLU is frequently downregulated by promoter hypermethylation in myelodysplastic syndrome.Yang Y et al
158858842006Expression of candidate chromosome 3p21.3 tumor suppressor genes and down-regulation of BLU in some esophageal squamous cell carcinomas.Yi Lo PH et al
227274082012Tumor suppressor BLU inhibits proliferation of nasopharyngeal carcinoma cells by regulation of cell cycle, c-Jun N-terminal kinase and the cyclin D1 promoter.Zhang X et al

Other Information

Locus ID:

NCBI: 51364
MIM: 607070
HGNC: 19412
Ensembl: ENSG00000004838

Variants:

dbSNP: 51364
ClinVar: 51364
TCGA: ENSG00000004838
COSMIC: ZMYND10

RNA/Proteins

Gene IDTranscript IDUniprot
ENSG00000004838ENST00000231749O75800
ENSG00000004838ENST00000360165O75800
ENSG00000004838ENST00000431869F2Z3M9
ENSG00000004838ENST00000442887C9JUQ8
ENSG00000004838ENST00000443080F2Z3M9

Expression (GTEx)

0
50
100
150
200
250
300
350
400

References

Pubmed IDYearTitleCitations
318016192019ZMYND10, an epigenetically regulated tumor suppressor, exerts tumor-suppressive functions via miR145-5p/NEDD9 axis in breast cancer.9
318016192019ZMYND10, an epigenetically regulated tumor suppressor, exerts tumor-suppressive functions via miR145-5p/NEDD9 axis in breast cancer.9
280296522017Tumor suppressor BLU promotes TRAIL-induced apoptosis by downregulating NF-κB signaling in nasopharyngeal carcinoma.3
280296522017Tumor suppressor BLU promotes TRAIL-induced apoptosis by downregulating NF-κB signaling in nasopharyngeal carcinoma.3
268247612016ZMYND10--Mutation Analysis in Slavic Patients with Primary Ciliary Dyskinesia.6
268247612016ZMYND10--Mutation Analysis in Slavic Patients with Primary Ciliary Dyskinesia.6
253477452015Anti-angiogenic pathway associations of the 3p21.3 mapped BLU gene in nasopharyngeal carcinoma.9
260438752015Inactivation of BLU is associated with methylation of Sp1-binding site of BLU promoter in gastric cancer.4
253477452015Anti-angiogenic pathway associations of the 3p21.3 mapped BLU gene in nasopharyngeal carcinoma.9
260438752015Inactivation of BLU is associated with methylation of Sp1-binding site of BLU promoter in gastric cancer.4
227667452013Loss of heterozygosity and methylation of multiple tumor suppressor genes on chromosome 3 in hepatocellular carcinoma.18
233296492013Epigenetic silencing of BLU through interfering apoptosis results in chemoresistance and poor prognosis of ovarian serous carcinoma patients.10
236284172013Tumor suppressor BLU promotes paclitaxel antitumor activity by inducing apoptosis through the down-regulation of Bcl-2 expression in tumorigenesis.10
238914692013ZMYND10 is mutated in primary ciliary dyskinesia and interacts with LRRC6.97
238914712013Mutations in ZMYND10, a gene essential for proper axonemal assembly of inner and outer dynein arms in humans and flies, cause primary ciliary dyskinesia.86

Citation

Xiangning Zhang ; Michael I Lerman ; Zhiwei He

ZMYND10 (zinc finger, MYND-type containing 10)

Atlas Genet Cytogenet Oncol Haematol. 2014-07-01

Online version: http://atlasgeneticsoncology.org/gene/45815/zmynd10-(zinc-finger-mynd-type-containing-10)