TAGLN (transgelin)
2010-09-01 Stephen Assinder   AffiliationPhysiology, School of Medical Sciences & Bosch Institute, F13 - Anderson Stuart Building, University of Sydney, Australia
Identity
HGNC
LOCATION
11q23.3
LOCUSID
ALIAS
SM22,SM22-alpha,SMCC,TAGLN1,WS3-10
FUSION GENES
DNA/RNA

Figure 1. Gene structure showing 5 exonic regions (boxes) and 4 intronic regions (lines). Expanded promoter provides relative positions of promoters upstream (-) and downstream (+) of start site. CarG = serum response binding box; TCE = TGF-beta control element; SBE = Smad binding element. Resulting transcript is given, with 5 and 3 UTRs (broken line) and translated region (solid line).
Description
5.4 kb gene located on 11q23.2 consisting of 5 exons, a large intron 1 and 3 short introns. Several putative promoters present in 800 bp upstream region.
Transcription
A 1566 bp transcript is generated from TAGLN. All exon 1 and first 12 bp of exon 2 are untranslated. As are the last 432 bp of exon 5.
Proteins
Note
Translated protein sequence is:
MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLY
PDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAV
TKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLY
PDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAV
TKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

Figure 2. Primary protein structure with amino acid (aa) positions of the calponin homologue (CH) region with calcium binding site (EF-hand) and actin binding calponin-like (CLIK) region. CKII and PKC refer to putative caseine kinase II and protein kinase C phosphorylation sites respectively.
Description
A 201 aa peptide member of the calponin family of actin binding proteins by virtue of a N-terminal calponin homologue domain and a single C-terminal calponin-like module. This C-terminal CLIK is required for actin binding.
Expression
Expression profiles are a point of debate. It is found throughout normal smooth muscle of adult vertebrates. It is also found outside of smooth muscle in the spinal chord, adrenal gland and heart, mesenchymal cells and fibroblasts, epithelium of the intestine, glomerular, breast and prostate.
Localisation
It is localised to the cytosol where it binds to F-actin.
Function
Transgelin is an actin stress fibre binding protein. It gels and stabilises actin gels. In the embryo it is involved in podosome formation and myocyte migration, vascular and visceral smooth muscle cell differentiation, and in the suppression of matrix metallo protease 9 (MMP9) where it is thought to be involved in the suppression of tissue re-modelling following muscle cell differentiation. Similarly in the adult, it is thought to suppress tumour cell invasion through MMP-9 suppression. Furthermore, it has been reported to suppress translocation of androgen receptor to the nucleus. Its expression is down-regulated in many cell lines, and this may be an early marker of the onset of transformation. Indeed it is becoming increasingly evident that transgelin may act as a tumour suppressor.
Implicated in
Entity name
Various cancers
Note
Disorganisation of the actin cytoskeleton is a fundamental event of the developing cancer cell phenotype. Transgelin is one of several proteins that bind actin and subsequently cross-link and bundle filaments into stress fibres. Expression is decreased in prostate, breast and colon cancers.
Entity name
Prostate cancer
Note
Transgelin is one of the 2% most significant of all down regulated genes in prostate cancer. Its expression has been shown to decrease with disease progression with lowest expression in metastasised lesions. Loss of transgelin may be significant to suppression of androgen induced proliferation of androgen dependant prostate cancer as it prevents binding of a co-activator to androgen receptor, thereby blocking nuclear translocation and resulting in suppression of androgen mediated cell growth. Recent studies suggest that transgelin promotes p53 mediated mitochondrial dependent apotptosis. Indeed coimmunoprecipitation and two hybrid studies have shown p53 and transgelin to be binding partners, with re-expression of transgelin promoting cytoplasmic p53 translocation in the prostate cancer cell line LNCaP. The value of transgelin as a target for selenium treatment has very recently been highlighted in a mouse model of prostate cancer (TRAMP mouse) where transgelin is increased with an associated decrease in tumour development.
Prognosis
Unknown.
Entity name
Colorectal cancer
Note
Loss of transgelin is closely associated with progression, differentiation and metastasis of colon cancer. Restoration of transgelin expression both in vitro and in vivo inhibits carcinogenesis. Decreased expression of transgelin in patients with colorectal cancer is associated with elevated levels of anti-transgelin antibodies, particularly during later stages, and subsequently with lower survival.
Prognosis
Decreased transgelin is associated with poor prognosis.
Entity name
Breast cancer
Note
Expression of transgelin occurs early in the disease process, possibly through constitutive ras activation.
Prognosis
Unknown.
Entity name
Ischaemic heart disease and vascular inflammation
Note
Coronary arteries of the ischemic heart display increased abundance of transgelin. In TAGLN null mice inflammatory response is increased following carotid artery injury. It is suggested that transgelin suppresses pro-inflamatory NF kappa B and oxidative stress (via suppression of superoxide dismutase and p47 phox).
Article Bibliography
| Pubmed ID | Last Year | Title | Authors |
|---|---|---|---|
| 18378184 | 2009 | Transgelin: an actin-binding protein and tumour suppressor. | Assinder SJ et al |
| 9615232 | 1998 | Expression and cytogenetic localization of the human SM22 gene (TAGLN). | Camoretti-Mercado B et al |
| 12582250 | 2003 | Smad proteins regulate transcriptional induction of the SM22alpha gene by TGF-beta. | Chen S et al |
| 17464194 | 2007 | SM22alpha is required for agonist-induced regulation of contractility: evidence from SM22alpha knockout mice. | Je HD et al |
| 9384215 | 1997 | Fibroblast transgelin and smooth muscle SM22alpha are the same protein, the expression of which is down-regulated in many cell lines. | Lawson D et al |
| 3818630 | 1987 | Isolation and characterization of an abundant and novel 22-kDa protein (SM22) from chicken gizzard smooth muscle. | Lees-Miller JP et al |
| 16835221 | 2006 | Expression cloning identifies transgelin (SM22) as a novel repressor of 92-kDa type IV collagenase (MMP-9) expression. | Nair RR et al |
| 20012321 | 2010 | Expression of the actin-associated protein transgelin (SM22) is decreased in prostate cancer. | Prasad PD et al |
| 11773051 | 2002 | Loss of transgelin in breast and colon tumors and in RIE-1 cells by Ras deregulation of gene expression through Raf-independent pathways. | Shields JM et al |
| 17082327 | 2007 | Transgelin functions as a suppressor via inhibition of ARA54-enhanced androgen receptor transactivation and prostate cancer cell growth. | Yang Z et al |
Other Information
Locus ID:
NCBI: 6876
MIM: 600818
HGNC: 11553
Ensembl: ENSG00000149591
Variants:
dbSNP: 6876
ClinVar: 6876
TCGA: ENSG00000149591
COSMIC: TAGLN
RNA/Proteins
Expression (GTEx)
Protein levels (Protein atlas)
References
| Pubmed ID | Year | Title | Citations |
|---|---|---|---|
| 37203411 | 2023 | Transgelin promotes ferroptosis to inhibit the malignant progression of esophageal squamous cell carcinoma. | 0 |
| 37290124 | 2023 | Hypoxia-Inducible Factor-1α in SM22α-Expressing Cells Modulates Alveolarization. | 1 |
| 37806182 | 2023 | LZTS3/TAGLN Suppresses Cancer Progression in Human Colorectal Adenocarcinoma Through Regulating Cell Proliferation, Migration, and Actin Cytoskeleton. | 0 |
| 37847687 | 2023 | Loss of prolyl hydroxylase 1 and 2 in SM22α-expressing cells prevents Hypoxia-Induced pulmonary hypertension. | 1 |
| 37203411 | 2023 | Transgelin promotes ferroptosis to inhibit the malignant progression of esophageal squamous cell carcinoma. | 0 |
| 37290124 | 2023 | Hypoxia-Inducible Factor-1α in SM22α-Expressing Cells Modulates Alveolarization. | 1 |
| 37806182 | 2023 | LZTS3/TAGLN Suppresses Cancer Progression in Human Colorectal Adenocarcinoma Through Regulating Cell Proliferation, Migration, and Actin Cytoskeleton. | 0 |
| 37847687 | 2023 | Loss of prolyl hydroxylase 1 and 2 in SM22α-expressing cells prevents Hypoxia-Induced pulmonary hypertension. | 1 |
| 35776288 | 2022 | RNA-sequencing of human aortic valves identifies that miR-629-3p and TAGLN miRNA-mRNA pair involving in calcified aortic valve disease. | 4 |
| 35776288 | 2022 | RNA-sequencing of human aortic valves identifies that miR-629-3p and TAGLN miRNA-mRNA pair involving in calcified aortic valve disease. | 4 |
| 33771884 | 2021 | TAGLN Is Downregulated by TRAF6-Mediated Proteasomal Degradation in Prostate Cancer Cells. | 5 |
| 33961858 | 2021 | m(6)A demethylase ALKBH5 suppresses proliferation and migration of enteric neural crest cells by regulating TAGLN in Hirschsprung's disease. | 6 |
| 34001947 | 2021 | Identification of targets of JS-K against HBV-positive human hepatocellular carcinoma HepG2.2.15 cells with iTRAQ proteomics. | 5 |
| 34338296 | 2021 | The canonical smooth muscle cell marker TAGLN is present in endothelial cells and is involved in angiogenesis. | 19 |
| 34538264 | 2021 | TAGLN mediated stiffness-regulated ovarian cancer progression via RhoA/ROCK pathway. | 21 |
Citation
Stephen Assinder
TAGLN (transgelin)
Atlas Genet Cytogenet Oncol Haematol. 2010-09-01
Online version: http://atlasgeneticsoncology.org/gene/46168/gene-fusions/submit-meetings/
