SRC (v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian))
2009-04-01 Stephen Hiscox   AffiliationWelsh School of Pharmacy, Redwood Building, Cardiff University, Cardiff, UK
Identity
DNA/RNA
Note
Description
mRNA: 4145 bases.
Proteins
Note
Protein Translation:
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRA
GPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRE
GQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGET
GKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAAL
YGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQA
FLEDYFTSTEPQYQPGENL
Note: This variant (isoform 1) represents the longer Src transcript although both isoforms 1 and 2 encode the same protein as the difference is in the 5 UTR.

Description
Src is 59.6KDa in size and has a domain structure comprised of six distinct functional regions (see figure above). These include an N-terminal SH4 domain that contains a lipid-modification sequence allowing targeting of Src to cellular membranes, and an adjacent, poorly-conserved region thus being unique to each Src family member. SH3 and SH2 domains adjacent to the N-terminus facilitate protein-protein interactions between Src and its interacting proteins whilst the SH1 domain allows ATP and substrate binding and has tyrosine kinase activity; autophosphorylation of Y419 within this domain is required for the maximum kinase activity of Src. The negative regulatory tail of Src contains a tyrosine at 530, the phosphorylation of which promotes a conformational change to produce an inactive Src molecule. Sequences within the C-terminus of Src have been recently identified to facilitate protein-protein interactions have been shown to regulate Src function in addition to its kinase activity.
Expression
Localisation
Function
Homology
| Src family member | % identity* | % similarity** |
| Fyn | 75 | 10 |
| Yes | 73 | 9 |
| Fgr | 66 | 11 |
| Lck | 60 | 17 |
| Lyn | 60 | 17 |
| Hck | 57 | 17 |
| Blk | 62 | 13 |
*Percent identity between Src and protein; defined as: (Same AAs/Length of Protein 1) X100%
**Percent similarity between Src and protein; defined as: (Sim. AAs/Length of Protein 1) X100%
Mutations
Somatic
Implicated in
Oestrogenic signalling plays a critical role in promoting breast cancer cell growth where ligand-induced activation of oestrogen receptors (ERs) results in gene transcription mediated by the ER, in complex with various co-activators/co-repressor molecules. In such cases, Src is able to potentiate ER-mediated, AF-1 dependent gene transcription through indirect phosphorylation of nuclear ER via ERK1/ ERK2 (Feng et al., 2001) and Akt (Campbell et al., 2001; Shah et al., 2005) and through regulation of FAK-p130CAS-JNK signalling pathway activity and the subsequent activation of co-activator molecules including CBP ( PAG1) and GRIP1 ( NCOA2). Furthermore, Src appears to mediate non-genomic ER signalling through ERK and Akt pathways (Castoria et al., 2001; Wessler et al., 2006) to regulate cellular proliferation and survival (Castoria et al., 1999; Migliaccio et al., 2000). That Src is involved in both EGFR/Her2 and ER signalling has led to Src being implicated in growth factor-ER cross talk mechanisms in breast cancer and the development of endocrine resistance (Arpino et al., 2008; Massarweh and Schiff, 2006; Hiscox et al., 2006; Hiscox et al., 2009).
Article Bibliography
| Pubmed ID | Last Year | Title | Authors |
|---|---|---|---|
| 11900220 | 2002 | Activation of Src kinase in primary colorectal carcinoma: an indicator of poor clinical prognosis. | Aligayer H et al |
| 18216219 | 2008 | Crosstalk between the estrogen receptor and the HER tyrosine kinase receptor family: molecular mechanism and clinical implications for endocrine therapy resistance. | Arpino G et al |
| 11250711 | 2000 | Tyrosine kinase signalling in breast cancer: epidermal growth factor receptor and c-Src interactions in breast cancer. | Biscardi JS et al |
| 18625340 | 2008 | Src and focal adhesion kinase as therapeutic targets in cancer. | Brunton VG et al |
| 11139588 | 2001 | Phosphatidylinositol 3-kinase/AKT-mediated activation of estrogen receptor alpha: a new model for anti-estrogen resistance. | Campbell RA et al |
| 7509341 | 1994 | Elevated c-Src tyrosine kinase activity in premalignant epithelia of ulcerative colitis. | Cartwright CA et al |
| 11689445 | 2001 | PI3-kinase in concert with Src promotes the S-phase entry of oestradiol-stimulated MCF-7 cells. | Castoria G et al |
| 18679417 | 2008 | Src family kinase oncogenic potential and pathways in prostate cancer as revealed by AZD0530. | Chang YM et al |
| 2448318 | 1987 | Analysis of pp60c-src tyrosine kinase activity and phosphotyrosyl phosphatase activity in human colon carcinoma and normal human colon mucosal cells. | DeSeau V et al |
| 7612268 | 1995 | Src family protein tyrosine kinases and cellular signal transduction pathways. | Erpel T et al |
| 11145737 | 2001 | Potentiation of estrogen receptor activation function 1 (AF-1) by Src/JNK through a serine 118-independent pathway. | Feng W et al |
| 16859511 | 2006 | Beta3 integrin and Src facilitate transforming growth factor-beta mediated induction of epithelial-mesenchymal transition in mammary epithelial cells. | Galliher AJ et al |
| 18508491 | 2008 | Microenvironmental regulation of E-cadherin-mediated adherens junctions. | Giehl K et al |
| 18493848 | 2009 | Dual targeting of Src and ER prevents acquired antihormone resistance in breast cancer cells. | Hiscox S et al |
| 17259559 | 2006 | Src as a therapeutic target in anti-hormone/anti-growth factor-resistant breast cancer. | Hiscox S et al |
| 17363590 | 2007 | Integrin alpha v beta 3 controls activity and oncogenic potential of primed c-Src. | Huveneers S et al |
| 9988270 | 1999 | Activating SRC mutation in a subset of advanced human colon cancers. | Irby RB et al |
| 11114744 | 2000 | Role of Src expression and activation in human cancer. | Irby RB et al |
| 12402152 | 2002 | Elevated c-Src is linked to altered cell-matrix adhesion rather than proliferation in KM12C human colorectal cancer cells. | Jones RJ et al |
| 18203007 | 2008 | Src-family kinases in the development and therapy of Philadelphia chromosome-positive chronic myeloid leukemia and acute lymphoblastic leukemia. | Li S et al |
| 17259554 | 2006 | Resistance to endocrine therapy in breast cancer: exploiting estrogen receptor/growth factor signaling crosstalk. | Massarweh S et al |
| 17595221 | 2007 | GPCRs signaling directly through Src-family kinases. | McGarrigle D et al |
| 11032808 | 2000 | Steroid-induced androgen receptor-oestradiol receptor beta-Src complex triggers prostate cancer cell proliferation. | Migliaccio A et al |
| 15528270 | 2005 | The Src kinase pathway promotes tamoxifen agonist action in Ishikawa endometrial cells through phosphorylation-dependent stabilization of estrogen receptor (alpha) promoter interaction and elevated steroid receptor coactivator 1 activity. | Shah YM et al |
| 15489919 | 2004 | Role of STATs as downstream signal transducers in Src family kinase-mediated tumorigenesis. | Silva CM et al |
| 12884910 | 2003 | Src family kinases in tumor progression and metastasis. | Summy JM et al |
| 15753384 | 2005 | ErbB2 promotes Src synthesis and stability: novel mechanisms of Src activation that confer breast cancer metastasis. | Tan M et al |
| 9442882 | 1997 | Cellular functions regulated by Src family kinases. | Thomas SM et al |
| 12753909 | 2003 | Heregulin and HER2 signaling selectively activates c-Src phosphorylation at tyrosine 215. | Vadlamudi RK et al |
| 9014858 | 1996 | c-Src protein expression is increased in human breast cancer. An immunohistochemical and biochemical analysis. | Verbeek BS et al |
| 18570353 | 2008 | Sensing estrogen's many pathways. | Weatherman RV et al |
| 16203130 | 2006 | Identification of estrogen receptor ligands leading to activation of non-genomic signaling pathways while exhibiting only weak transcriptional activity. | Wessler S et al |
Other Information
Locus ID:
NCBI: 6714
MIM: 190090
HGNC: 11283
Ensembl: ENSG00000197122
Variants:
dbSNP: 6714
ClinVar: 6714
TCGA: ENSG00000197122
COSMIC: SRC
RNA/Proteins
| Gene ID | Transcript ID | Uniprot |
|---|---|---|
| ENSG00000197122 | ENST00000358208 | P12931 |
| ENSG00000197122 | ENST00000373558 | P12931 |
| ENSG00000197122 | ENST00000373567 | P12931 |
| ENSG00000197122 | ENST00000373578 | P12931 |
Expression (GTEx)
Pathways
Protein levels (Protein atlas)
PharmGKB
| Entity ID | Name | Type | Evidence | Association | PK | PD | PMIDs |
|---|---|---|---|---|---|---|---|
| PA30616 | MAPK1 | Gene | Pathway | associated | |||
| PA59 | ARRB1 | Gene | Pathway | associated | |||
| PA60 | ARRB2 | Gene | Pathway | associated |
References
| Pubmed ID | Year | Title | Citations |
|---|---|---|---|
| 38097740 | 2024 | Compartment-specific multiomic profiling identifies SRC and GNAS as candidate drivers of epithelial-to-mesenchymal transition in ovarian carcinosarcoma. | 1 |
| 38108278 | 2024 | Oxidative Stress Participates in Age-Related Cataract Formation by Disrupting Connection between Lens Epithelial Cells through c-Src/VEGF Pathway. | 0 |
| 38281617 | 2024 | ING3 inhibits the malignant progression of lung adenocarcinoma by negatively regulating ITGB4 expression to inactivate Src/FAK signaling. | 0 |
| 38347536 | 2024 | Superbinder based phosphoproteomic landscape revealed PRKCD_pY313 mediates the activation of Src and p38 MAPK to promote TNBC progression. | 0 |
| 38480477 | 2024 | FAXC interacts with ANXA2 and SRC in mitochondria and promotes tumorigenesis in cholangiocarcinoma. | 1 |
| 38742902 | 2024 | LINC08148 promotes the caveola-mediated endocytosis of Zika virus through upregulating transcription of Src. | 0 |
| 38097740 | 2024 | Compartment-specific multiomic profiling identifies SRC and GNAS as candidate drivers of epithelial-to-mesenchymal transition in ovarian carcinosarcoma. | 1 |
| 38108278 | 2024 | Oxidative Stress Participates in Age-Related Cataract Formation by Disrupting Connection between Lens Epithelial Cells through c-Src/VEGF Pathway. | 0 |
| 38281617 | 2024 | ING3 inhibits the malignant progression of lung adenocarcinoma by negatively regulating ITGB4 expression to inactivate Src/FAK signaling. | 0 |
| 38347536 | 2024 | Superbinder based phosphoproteomic landscape revealed PRKCD_pY313 mediates the activation of Src and p38 MAPK to promote TNBC progression. | 0 |
| 38480477 | 2024 | FAXC interacts with ANXA2 and SRC in mitochondria and promotes tumorigenesis in cholangiocarcinoma. | 1 |
| 38742902 | 2024 | LINC08148 promotes the caveola-mediated endocytosis of Zika virus through upregulating transcription of Src. | 0 |
| 36577884 | 2023 | Expression of estrogen receptors, PELP1, and SRC in human spermatozoa and their associations with semen quality. | 1 |
| 36633714 | 2023 | Tyrosine kinase SRC-induced YAP1-KLF5 module regulates cancer stemness and metastasis in triple-negative breast cancer. | 5 |
| 36692364 | 2023 | Disordered Domain Shifts the Conformational Ensemble of the Folded Regulatory Domain of the Multidomain Oncoprotein c-Src. | 1 |
Citation
Stephen Hiscox
SRC (v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian))
Atlas Genet Cytogenet Oncol Haematol. 2009-04-01
Online version: http://atlasgeneticsoncology.org/gene/448/case-report-explorer/tumors-explorer/gene-explorer/hgnc
