EEF1G (Eukaryotic translation elongation factor 1 gamma)
2019-03-01 Luigi Cristiano, MSc AffiliationAesthetic and medical biotechnologies research unit, Prestige, Terranuova Bracciolini, Italy; [email protected]
Abstract
Eukaryotic translation elongation factor 1 gamma, alias eEF1G, is a protein that plays a main function in the elongation step of translation process but also covers numerous moonlighting roles. Considering its importance in the cell it is found frequently overexpressed in human cancer cells and thus this review wants to collect the state of the art about EEF1G, with insights on DNA, RNA, protein encoded and the diseases where it is implicated.
DNA/RNA

Description
Transcription
Five splice variants for EEF1G were observed (Table.1): the main reference variant is EEF1G-001 and the others are EEF1G-002, EEF1G-003, EEF1G-004 and EEF1G-201 (Figure.1). Only two of which codify for a protein, i.e. EEF1G-001 and EEF1G-201, while the others are non-coding RNA sequences (ncRNAs), classified as processed transcripts, i.e. nucleotide sequences that do not contain an open reading frame (ORF) and alternatively spliced transcripts, i.e. retained intron sequences. Furthermore, there is a potential readthrough with the inclusion of TUT1 gene.
| Variant | Name | RefSeq (1) | Transcript ID | Exons | Type | Lenght (bp) | RefSeq (2) | Lenght (aa) |
| 1 | EEF1G-001 | NM_001404.5 | - | 10 | Protein coding | 1446 | NP_001395.1 | 437 |
| 2 | EEF1G-002 (EEF1G-203) | AK092787.1 | ENST00000525340.5 | 9 | Retained intron | 2496 | - | - |
| 3 | EEF1G-003 (EEF1G-204) | - | ENST00000532986.1 | 5 | Processed transcript | 578 | - | - |
| 4 | EEF1G-004 (EEF1G-202) | - | ENST00000524420.5 | 5 | Processed transcript | 557 | - | - |
| 5 | EEF1G-201 | AK300203.1 | - | 10 | Protein coding | 1631 | BAG61974.1 | 487 |
Table.1. Splice variants of EEF1G gene (reworked from http://grch37.ensembl.org)
Pseudogene
| Gene | Gene name | Gene ID | RefSeq | Locus | Location | Start | End | Lenght (nt) |
| EEF1GP1 | EEF1G1 Pseudogene 1 | 646837 | NC_000007.14 | Chromosome 7 | 7q31.33 | 125033433 | 125035389 | 1957 |
| EEF1GP2 | EEF1G1 Pseudogene 2 | 100130260 | NC_000005.10 | Chromosome 5 | 5q32 | 147922182 | 147923422 | 1241 |
| EEF1GP3 | EEF1G1 Pseudogene 3 | 651628 | NC_000003.12 | Chromosome 3 | 3p22.1 | 40596122 | 40597519 | 1398 |
| EEF1GP4 | EEF1G1 Pseudogene 4 | 100129403 | NC_000003.12 | Chromosome 3 | 3q26.1 | 161324837 | 161326238 | 1402 |
| EEF1GP5 | EEF1G1 Pseudogene 5 | 642357 | NC_000023.11 | Chromosome X | Xq23 | 115702791 | 115704195 | 1405 |
| EEF1GP6 | EEF1G1 Pseudogene 6 | 100421733 | NC_000006.12 | Chromosome 6 | 6q16.1 | 96750800 | 96751728 | 929 |
| EEF1GP7 | EEF1G1 Pseudogene 7 | 645311 | NC_000001.11 | Chromosome 1 | 1p32.3 | 52573115 | 52573818 | 704 |
| EEF1GP8 | EEF1G1 Pseudogene 8 | 391698 | NC_000004.12 | Chromosome 4 | 4q28.2 | 129903001 | 129904244 | 1244 |
| LOC729998 | EEF1G1 Pseudogene 9 | 729998 | NC_000007.14 | Chromosome 7 | 7q33 | 133034515 | 133035940 | 1426 |
Table.2 EEF1G pseudogene (reworked from https://www.ncbi.nlm.nih.gov/gene/1937)
Proteins
Note

Description
There are known two isoforms produced by alternative splicing: the isoform 1 (RefSeq NP_001395.1; UniParc, P26641-1), that has been chosen as the canonical sequence, is formed by 437 residues and has an overall molecular weight of 50.12 kDa, while the isoform 2 (RefSeq BAG61974.1; UniParc, P26641-2) is 487 amino acids long with 56.15 kDa of molecular weight. The sequence of this isoform differs from the canonical sequence for the substitution of the first four amino acids (MAAG) by the insertion of other fifty residues (MAERWVAPAVLRRARFASTFFLSPQIYAHKDGDLRSAFFILSFKRGEFIPFLNW) with the creation of an alternative amino acid sequence (Ota et al., 2004). No experimental data or other studies were performed for this isoform, so its biological role is totally unknown.
eEF1G shown hydrophobic properties, has a relatively high isoelectric point (pI ≈ 7) (van Damme et al., 1991) and the analysis of its primary and secondary structures revealed some interesting characteristics. In fact, it is a multi-domain protein which consists of three main domains: from the amino to carboxyl half terminal there are a glutathione S-transferase (GST)-like N-terminus domain (NT-eEF1G), a glutathione S-transferase (GST)-like C-terminus domain (CT-eEF1G) and a conserved C-terminal domain (CD-eEF1G) (Achilonu et al.,2014). NT-eEF1G and CT-eEF1G domains show a homology to the theta class of glutathione S-transferases (GSTs) (Koonin et al., 1994; Janssen and Möller, 1988).
The NT-eEF1G domain of eEF1G, by using secondary structure prediction algorithms, seems to have a predominant α-helix secondary structure (Achilonu et al.,2014) and it was demonstrated that interacts directly with the N-terminal domain of eEF1B (van Damme et al., 1991) and also with the N-terminal domain of eEF1D in independent manner (Cao et al., 2014; Mansilla et al., 2002; Janssen et al., 1994), although different interactional models were proposed (Le Sourd et al., 2006; Jiang et al.,2005; Sheu and Traugh, 1999; Minella et al., 1998). It does not seem to have a direct interaction with other eEF1H elements. In addition, the presence of an enzymatically active GST element could be involved in detoxification of oxygen radicals and the over-expression of eEF1G in cancer cells could influence their response to oxidative stress and their aggressiveness (Koonin et al., 1994).
The calculated secondary structure of the CT-eEF1G domain of eEF1G shows both α-helix and β-strand secondary structure elements (Achilonu et al.,2014) and does not interact with eEF1B but instead is the candidate domain to has transient interactions with other proteins or cell structures.
The CD-eEF1G domain of eEF1G seems to be mostly in α-helix secondary structure with few β-strands (Achilonu et al.,2014) and currently it does not show particular elements or interactions.
It is interesting that eEF1G shows two internal repeats of eight amino acids (VFGEXNXS) at positions 35 - 42 and 355 - 362 respectively, that are located in its amino-terminal and carboxy-terminal halves. The roles of these two octapeptides are still unknown even if they could cover the function of binding-sites (van Damme et al., 1991; Maessen et al., 1987).
eEF1G seems to have in human cells a dimeric nature, forming homodimers, while in rabbit shows a trimeric nature and in yeast was observed that it acts as a monomer (Achilonu et al.,2014; Koonin et al., 1994). Furthermore, it has hydrophobic properties that enable it to attach to membranes (Mansilla et al., 2002).
eEF1G interacts mainly with EEF1B2 and EEF1D, even if other interactions are documented in protein databases and in literature, i.e. with the histidyl-tRNA synthetase ( HARS), leucyl-tRNA synthetase ( LARS), cysteine-tRNA synthetase ( CARS), leucine zipper putative tumor suppressor 1 ( LZTS1), enoyl-CoA hydratase 1( ECH1), plasminogen receptor ( PLGRKT), small ubiquitin-related modifier 2 ( SUMO2), ATP-binding cassette sub-family C member 9 ( ABCC9), tripartite motif containing 55 ( TRIM55), E3 ubiquitin-protein ligase ( TRIM63), interleukin enhancer binding factor 2 ( ILF2), vascular cell adhesion protein 1 ( VCAM1), eukaryotic translation elongation factor 1 delta pseudogene 3 ( EEF1DP3), RNA-binding protein 6 ( RBM6) (HuRI database - http://interactome.baderlab.org/), ATP-dependent DNA helicase Q5 ( RECQL5) and fasciculation and elongation protein zeta 1 ( FEZ1)(Ishii et al., 2001) although the nature of these interactions are poorly understood.
Post-translational modifications. Some post-translational modifications are observed, such as phosphorylation, acetylation and S-nitrosylation.
1) Phosphorylation: it was demonstrated that eEF1G is a target of the kinases, in particular the cell cycle protein kinase CDK1 /cyclin B (Le Sourd et al., 2006; Mansilla et al., 2002). There are at least four positions for phosphorylation: two on threonine residues (T43, T230) and two on serine residues (S286, S406) (Olsen et al., 2010; http://hprd.org). It is assumed that these phosphorylations play a regulatory role, but their exact functional significance is poorly understood.
2) Acetylation: there are three positions for acetylation on lysine residues (K132, K147, K434) (Choudhary et al., 2009; http://hprd.org).
3) S-nitrosylation: there is one most probable position for S-Nitrosylation on a cysteine residue (C194) (Han and Chen, 2008; http://hprd.org).

Expression
The expression pattern in cell lines tested for its presence is similar and without significantly differences except in one study that revealed a higher expression in human embryonic kidney HEK293 cell line and in human liver hepatocellular carcinoma HepG2 cell line (Cao et al, 2014).
Localisation
Function
Canonical function: eEF1G binds to eEF1B and eEF1D and is supposed that its primary role may be to ensure the proper scaffolding and stability of its binding partners in the eEF1BDG macromolecular complex and then it could anchors the entire EF1H complex to the endoplasmic reticulum together with the ribosome (Mansilla et al., 2002; Janssen et al., 1994). However, the complete significance of the role of human eEF1G remains unknown and needs to be more studied.
Non-canonical roles: eEF1G has shown to interact with cytoskeleton, RNA polymerase II, TNF receptor-associated protein 1 ( TRAP1) and membrane-bound receptors. In addition, it was observed that it has mRNA binding properties and it is a positive regulator of NF-kB signaling pathway.
1) eEF1G and cytoskeleton: it was discovered that eEF1G is a structural component of the cytoskeleton (Coumans et al., 2014), in fact it can bind both keratin intermediate filaments (Kim et al., 2017) and the tubulin (Janssen and Möller, 1988). This suggests that it may have an influence on cytoskeletal architecture, cell morphology and motility, but these implications and the roles of these bindings are still need to clarify.
2) eEF1G and interaction with RNA polymerase II: it physically interacts with RNA polymerase II (pol II) core subunit 3 ( POLR2C), both in isolation and in the context of the holo-enzyme (Corbi et al., 2010).
3) interaction between eEF1G and TNF receptor-associated protein 1 (TRAP1): TRAP1 is the main mitochondrial member of the heat shock protein (HSP) 90 family and it was revealed that there is an interaction between this protein and some members of eEF1H complex, including eEF1G. The role of the interaction between eEF1G and TRAP1 is related to the translational control (Matassa et al., 2013) and maybe also in the protection to oxidative stress (Pisani et al., 2016).
4) eEF1G and membrane-bound receptors (dopamine D3 receptor): it was observed that there is an interaction between eEF1G and dopamine D3 receptor ( DRD3) and that they have a co-localization on the plasma membrane. This interaction involve also eEF1B subunit after its protein kinase-mediated phosphorylation on its serine residues. eEF1G acts as a bridge for the relation between eEF1B and DRD3 and these three factors together forming a new macromolecular complex on the plasma membrane that obviously play some roles even if its functional meaning is still understood (Cho et al., 2003).
5) mRNA binding properties: the presence of eEF1G was detected on the genomic locus corresponding to the promoter region of human vimentin gene VIM and this permits to suppose that eEF1G regulates vimentin gene by contacting both pol II and the vimentin promoter region. In addition was shown that it can bind to 3UTR of vimentin mRNA and so it can shuttling/nursing the vimentin mRNA from its gene locus to its appropriate cellular compartment for translation. In fact, depletion of eEF1G causes the incorrect compartmentalizing of the vimentin protein and seriously compromise cellular shape and mitochondria localization (Corbi et al., 2010). Furthermore, was shown that eEF1G can bind also AATF (Che-1) and transcription and their promoter regions (Pisani et al., 2016).
6) regulation of NF-kB signaling pathway: eEF1G can binds to the CARD domain of mitochondrial antiviral-signaling protein ( MAVS) and thus significantly promotes the activities of transcription factor NF-kB functioning as its positive regulator. The discover offers a new regulating mechanism of the antiviral responses that promotes the downstream pro-inflammatory cytokines CXCL8 (interleukin-8 (IL8)) and interleukin-6 ( IL6) (Liu et al., 2014).
Homology
| Organism (1) | Organism (2) | Symbol | Similarity (%) |
| Human | H.sapiens | eEF1G | 100 |
| Chimpanzee | P.troglodytes | eEF1G | 100 |
| Gorilla | G.gorilla gorilla | eEF1G | 99 |
| Cat | Felis catus | eEF1G | 99 |
| Mouse | M.musculus | eEF1G | 98 |
| Rat | R.norvegicus | eEF1G | 98 |
| Zebrafish | D.rerio | eEF1G | 75 |
| Drosophila | D.melanogaster | Ef1gamma | 58 |
| Caenorhabditis | C.elegans | F17C11.9 | 52 |
| Yeast | S.cerevisiae | TEF4 | 38 |
Table.3 eEF1G homology (reworked from https://cgap.nci.nih.gov;
Mutations
Note
Implicated in
The overexpression of eEF1G in the colorectal cancers seems to be not due to gene amplification, genome rearrangements or an increase in the number of cycling cells (Frazier et al., 1998).
Interestingly is the positive correlation that was found in this cancer type between co-expression levels of TNF Receptor Associated Protein 1 (TRAP1) and eEF1G: the majority of the TRAP1-positive tumors exhibit an upregulation of eEF1G and, on the contrary, tumors with low expression of TRAP1 also exhibit low levels of expression of eEF1G (Matassa et al., 2013). This evidence may have an interesting significance in the increase or decrease of tumor aggressiveness and in the development of new anti-cancer strategies. Moreover, the reduction of expression levels of eEF1G in high-risk patients can predict poor survival (Hassan et al., 2018).
Article Bibliography
| Pubmed ID | Last Year | Title | Authors |
|---|---|---|---|
| 20078854 | 2010 | Gene expression profiling of peripheral blood cells for early detection of breast cancer. | Aarøe J et al |
| 24732582 | 2014 | Purification and characterisation of recombinant human eukaryotic elongation factor 1 gamma. | Achilonu I et al |
| 24367274 | 2013 | Comprehensive analysis of transcriptome variation uncovers known and novel driver events in T-cell acute lymphoblastic leukemia. | Atak ZK et al |
| 22960745 | 2012 | Comprehensive genomic characterization of squamous cell lung cancers. | |
| 25436608 | 2014 | Characterisation of translation elongation factor eEF1B subunit expression in mammalian cells and tissues and co-localisation with eEF1A2. | Cao Y et al |
| 1612363 | 1992 | Expression of an elongation factor 1 gamma-related sequence in adenocarcinomas of the colon. | Chi K et al |
| 14519448 | 2003 | Direct and biochemical interaction between dopamine D3 receptor and elongation factor-1Bbetagamma. | Cho DI et al |
| 19608861 | 2009 | Lysine acetylation targets protein complexes and co-regulates major cellular functions. | Choudhary C et al |
| 21217813 | 2010 | The eEF1γ subunit contacts RNA polymerase II and binds vimentin promoter region. | Corbi N et al |
| 23899627 | 2014 | Green fluorescent protein expression triggers proteome changes in breast cancer cells. | Coumans JV et al |
| 11866090 | 2002 | Moonlighting functions of polypeptide elongation factor 1: from actin bundling to zinc finger protein R1-associated nuclear localization. | Ejiri S et al |
| 8382068 | 1993 | Overexpression of an elongation factor-1 gamma-hybridizing RNA in colorectal adenomas. | Ender B et al |
| 24309898 | 2014 | Analysis of the human tissue-specific expression by genome-wide integration of transcriptomics and antibody-based proteomics. | Fagerberg L et al |
| 9609096 | 1998 | Few point mutations in elongation factor-1gamma gene in gastrointestinal carcinoma. | Frazier ML et al |
| 30598115 | 2018 | Identification of cancer subtypes from single-cell RNA-seq data using a consensus clustering method. | Gan Y et al |
| 18335467 | 2008 | Detergent-free biotin switch combined with liquid chromatography/tandem mass spectrometry in the analysis of S-nitrosylated proteins. | Han P et al |
| 29286103 | 2018 | Gene expression profiling of acute myeloid leukemia samples from adult patients with AML-M1 and -M2 through boutique microarrays, real-time PCR and droplet digital PCR. | Handschuh L et al |
| 29342219 | 2018 | The expression profile and prognostic significance of eukaryotic translation elongation factors in different cancers. | Hassan MK et al |
| 12721631 | 2003 | An expressed pseudogene regulates the messenger-RNA stability of its homologous coding gene. | Hirotsune S et al |
| 11504921 | 2001 | FEZ1/LZTS1 gene at 8p22 suppresses cancer cell growth and regulates mitosis. | Ishii H et al |
| 7989307 | 1994 | The subunit structure of elongation factor 1 from Artemia. Why two alpha-chains in this complex? | Janssen GM et al |
| 16229838 | 2005 | Three-dimensional reconstruction of the valyl-tRNA synthetase/elongation factor-1H complex and localization of the delta subunit. | Jiang S et al |
| 17906640 | 2007 | Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. | Kim S et al |
| 25485619 | 2015 | A comprehensive transcriptional portrait of human cancer cell lines. | Klijn C et al |
| 7703850 | 1994 | Eukaryotic translation elongation factor 1 gamma contains a glutathione transferase domain--study of a diverse, ancient protein superfamily using motif search and structural modeling. | Koonin EV et al |
| 16624425 | 2006 | eEF1B: At the dawn of the 21st century. | Le Sourd F et al |
| 16548883 | 2006 | Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection. | Leong WF et al |
| 1372736 | 1992 | Expression of elongation factor-1 gamma-related sequence in human pancreatic cancer. | Lew Y et al |
| 23699257 | 2013 | The unexpected roles of eukaryotic translation elongation factors in RNA virus replication and pathogenesis. | Li D et al |
| 24613846 | 2014 | eEF1Bγ is a positive regulator of NF-кB signaling pathway. | Liu D et al |
| 3666137 | 1987 | Primary structure of elongation factor 1 gamma from Artemia. | Maessen GD et al |
| 11985494 | 2002 | Mapping the human translation elongation factor eEF1H complex using the yeast two-hybrid system. | Mansilla F et al |
| 24113185 | 2013 | Translational control in the stress adaptive response of cancer cells: a novel role for the heat shock protein TRAP1. | Matassa DS et al |
| 9486568 | 1998 | Overexpression of elongation factor-1gamma protein in colorectal carcinoma. | Mathur S et al |
| 7889472 | 1995 | The overexpression of elongation factor 1 gamma mRNA in gastric carcinoma. | Mimori K et al |
| 8891347 | 1996 | Major intracellular localization of elongation factor-1. | Minella O et al |
| 28497265 | 2017 | Proteomics analysis of pleomorphic adenoma of the human parotid gland. | Mutlu A et al |
| 20068231 | 2010 | Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. | Olsen JV et al |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | Ota T et al |
| 27840423 | 2017 | Novel ALK fusion in anaplastic large cell lymphoma involving EEF1G, a subunit of the eukaryotic elongation factor-1 complex. | Palacios G et al |
| 27639846 | 2016 | eEF1Bγ binds the Che-1 and TP53 gene promoters and their transcripts. | Pisani C et al |
| 23533145 | 2013 | In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine. | Principe S et al |
| 2278101 | 1990 | Eukaryotic protein elongation factors. | Riis B et al |
| 30008712 | 2018 | Strain-Specific Contribution of Eukaryotic Elongation Factor 1 Gamma to the Translation of Influenza A Virus Proteins. | Sammaibashi S et al |
| 8743958 | 1996 | Immunofluorescence studies of human fibroblasts demonstrate the presence of the complex of elongation factor-1 beta gamma delta in the endoplasmic reticulum. | Sanders J et al |
| 30079703 | 2019 | Investigation of Gene Expressions of Myeloma Cells in the Bone Marrow of Multiple Myeloma Patients by Transcriptome Analysis. | Sarıman M et al |
| 18248679 | 2008 | Up regulation in gene expression of chromatin remodelling factors in cervical intraepithelial neoplasia. | Shadeo A et al |
| 10094407 | 1999 | A structural model for elongation factor 1 (EF-1) and phosphorylation by protein kinase CKII. | Sheu GT et al |
| 10953316 | 2000 | Enhanced expression of translation factor mRNAs in hepatocellular carcinoma. | Shuda M et al |
| 14710232 | 2004 | Differential gene-expression profiles associated with gastric adenoma. | Takenawa H et al |
| 26725330 | 2016 | Proteomic maps of breast cancer subtypes. | Tyanova S et al |
| 30097214 | 2018 | Bioinformatics analysis of gene expression profiles to diagnose crucial and novel genes in glioblastoma multiform. | Vastrad C et al |
| 19175833 | 2009 | Cross-species hybridization of woodchuck hepatitis viral infection-induced woodchuck hepatocellular carcinoma using human, rat and mouse oligonucleotide microarrays. | Wang F et al |
| 22628567 | 2012 | Eukaryotic elongation factor 1 complex subunits are critical HIV-1 reverse transcription cofactors. | Warren K et al |
| 16820872 | 2006 | Gene expression profiling of human HBV- and/or HCV-associated hepatocellular carcinoma cells using expressed sequence tags. | Yoon SY et al |
| 2026171 | 1991 | Mapping the functional domains of the eukaryotic elongation factor 1 beta gamma. | van Damme H et al |
| 29057015 | 2017 | New developments in the pathology of malignant lymphoma: a review of the literature published from May to August 2017. | van Krieken JH et al |
| 28659337 | 2017 | Anaplastic lymphoma kinase-positive anaplastic large cell lymphoma with the variant RNF213-, ATIC- and TPM3-ALK fusions is characterized by copy number gain of the rearranged ALK gene. | van der Krogt JA et al |
Other Information
Locus ID:
NCBI: 1937
MIM: 130593
HGNC: 3213
Ensembl: ENSG00000254772
Variants:
dbSNP: 1937
ClinVar: 1937
TCGA: ENSG00000254772
COSMIC: EEF1G
RNA/Proteins
| Gene ID | Transcript ID | Uniprot |
|---|---|---|
| ENSG00000254772 | ENST00000329251 | P26641 |
| ENSG00000254772 | ENST00000329251 | Q53YD7 |
Expression (GTEx)
Pathways
Protein levels (Protein atlas)
References
| Pubmed ID | Year | Title | Citations |
|---|---|---|---|
| 27840423 | 2017 | Novel ALK fusion in anaplastic large cell lymphoma involving EEF1G, a subunit of the eukaryotic elongation factor-1 complex. | 8 |
| 27840423 | 2017 | Novel ALK fusion in anaplastic large cell lymphoma involving EEF1G, a subunit of the eukaryotic elongation factor-1 complex. | 8 |
| 27639846 | 2016 | eEF1Bγ binds the Che-1 and TP53 gene promoters and their transcripts. | 5 |
| 27639846 | 2016 | eEF1Bγ binds the Che-1 and TP53 gene promoters and their transcripts. | 5 |
| 21217813 | 2010 | The eEF1γ subunit contacts RNA polymerase II and binds vimentin promoter region. | 12 |
| 21217813 | 2010 | The eEF1γ subunit contacts RNA polymerase II and binds vimentin promoter region. | 12 |
Citation
Luigi Cristiano, MSc
EEF1G (Eukaryotic translation elongation factor 1 gamma)
Atlas Genet Cytogenet Oncol Haematol. 2019-03-01
Online version: http://atlasgeneticsoncology.org/gene/54272/eef1g
