Atlas of Genetics and Cytogenetics in Oncology and Haematology


Home   Genes   Leukemias   Solid Tumours   Cancer-Prone   Deep Insight   Case Reports   Journals  Portal   Teaching   

X Y 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 NA

PLA2G2A (phospholipase A2, group IIA (platelets, synovial fluid))

Written2010-05Robert T Cormier
Department of Biochemistry, Molecular Biology, University of Minnesota Medical School, Duluth, Minnesota, USA

(Note : for Links provided by Atlas : click)

Identity

Alias_namesPLA2B
PLA2L
phospholipase A2
Other aliasMOM1
PLA2
PLA2S
PLAS1
sPLA2
sPLA2-IIA
HGNC (Hugo) PLA2G2A
LocusID (NCBI) 5320
Atlas_Id 41730
Location 1p36.13  [Link to chromosome band 1p36]
Location_base_pair Starts at 20301924 and ends at 20306932 bp from pter ( according to hg19-Feb_2009)  [Mapping PLA2G2A.png]
Fusion genes
(updated 2016)
GFRA1 (10q25.3) / PLA2G2A (1p36.13)GNG7 (19p13.3) / PLA2G2A (1p36.13)PLA2G2A (1p36.13) / FBLN1 (22q13.31)
PLA2G2A (1p36.13) / ITGA6 (2q31.1)PLA2G2A (1p36.13) / MBTPS1 (16q23.3)PLA2G2A (1p36.13) / MLLT4 (6q27)
PLA2G2A (1p36.13) / RPS24 (10q22.3)PLA2G2A (1p36.13) / TAF15 (17q12)TMCO4 (1p36.13) / PLA2G2A (1p36.13)

DNA/RNA

 
  Figure 1. Structure of the PLA2G2A gene.
Description Background: The phospholipase A2 (PLA2s) superfamily, consisting of at least 34 members subdivided into at least 15 groups, is a group of intracellular and secreted enzymes that hydrolyzes the sn-2 ester bond in glycerophospholipids found in lipoproteins and cellular membranes to liberate fatty acids and lysophospholipids that can act as intracellular second messengers or are further metabolized into mediators of a variety of cellular processes such as inflammation, proliferation, apoptosis and atherogenesis. PLA2s are a diverse family of enzymes in terms of sequence, localization, function, and divalent cation requirements. PLA2s are classified into several groups based on their size, structure, and need for divalent cations. Groups I, II, and III all contain secreted forms of PLA2, which are extracellular enzymes that have a low molecular mass of ~14 kD and require calcium ions for catalysis. PLA2G2A belongs to the subfamily of group II sPLA2s, comprising PLA2 group IIA, PLA2 group IIC, PLA2 group IID, PLA2 group IIE, PLA2 group IIF, and PLA2 group V. All of these enzymes are encoded by a cluster of highly homologous genes located within a ~250 kb genomic segment on human chromosome 1p35, and on its homologous region on mouse distal chromosome 4.
PLA2G2A was first identified following the isolation and sequencing of proteins from the synovial fluid of human rheumatoid arthritis. A cDNA library prepared from peritoneal exudate cells identified a full-length PLA2G2A 0.8 kb transcript and cDNA of 435 nucleotides that encodes for a polypeptide of 144 amino acids with a molecular mass of 16 kD (~14 kD in the mature peptide). The protein was found to demonstrate features of the type II class of PLA2s, including conserved catalytic residues and a Ca2+-binding loop.
Structure: The PLA2G2A gene is 4.98 kb in length, with 6 total exons and 4 protein coding exons.
Transcription 0.8 kb transcript of 435 nucleotides:

atgaagaccctcctactgttggcagtgatcatgatctttggcctactgcaggcccatggg
aatttggtgaatttccacagaatgatcaagttgacgacaggaaaggaagccgcactcagt
tatggcttctacggctgccactgtggcgtgggtggcagaggatcccccaaggatgcaacg
gatcgctgctgtgtcactcatgactgttgctacaaacgtctggagaaacgtggatgtggc
accaaatttctgagctacaagtttagcaactcggggagcagaatcacctgtgcaaaacag
gactcctgcagaagtcaactgtgtgagtgtgataaggctgctgccacctgttttgctaga
aacaagacgacctacaataaaaagtaccagtactattccaataaacactgcagagggagc
acccctcgttgctga

The PLA2G2A gene produces multiple transcripts arising from splice variants and alternative promoter usage. There are believed to be at least seven splice variants produced by usage of the predominant promoter. The gene contains 6 exons with 4 exons containing protein coding regions. Variants are produced that have different 5' UTRs. The longest and predominant transcript is NM_000300 with a processed length of 970 nt and a mRNA of 997 nt. This produces a mature mRNA (NP_000291.1) of 435 nt that encodes for a polypeptide of 144 amino acids. The different splice variants either encode for the same polypeptide or encode for no protein product.
The PLA2G2A promoter contains TATA and CAAT boxes and elements with consensus sequences for binding of transcription factors such as AP-1, C/EBPs, CREB, NF-kB, STAT, LXR/RXR heterodimers, NFATs and PPARgamma. Although the promoter does not contain a typical CpG island there are CpG target sites at -82 and -111 and Sp1 binding may be inhibited by promoter hypermethylation. CpG sites also exist in the -1340 to -900 promoter region and in gastric cancer cell lines that did not express PLA2G2A these sites were hypermethylated, leading to PLA2G2A silencing. PLA2G2A has also been reported to be silenced by promoter hypermethylation in prostate cancer cells and Jurkat leukemia cells. PLA2G2A is a direct target of Wnt/beta catenin signaling, with multiple TCF/LEF transcription factor binding sites in the -1340 to -920 promoter region.
Trans acting regulators of PLA2G2A transcription include: Sp1, NF-kB p65, Jak/STAT, Rho-kinase, and C/EBP-beta. Expression of musashi-1, a putative stem cell marker, suppresses PLA2G2A expression in cell culture at the mRNA level. Notch1 activates PLA2G2A within intestinal epithelial cells and forced expression of Nicd1 in human CRC cells resulted in increased PLA2G2A expression.

Protein

Description Structure: 144 amino acids:
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAAL
SYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLE
KRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDK
AAATCFARNKTTYNKKYQYYSNKHCRGSTPRC

The protein has a 20 amino acid signal sequence and a 124 amino acid mature peptide with a molecular mass of ~14 kD. PLA2G2A has protein domains typical of Type II PLA2s that include a highly conserved catalytic region (DXCCXXHD) and a Ca2+-binding loop (XCGXGG). PLA2G2A also shares with other PLA2s the characteristic seven cysteine disulfide bridges that are important for regulation and protein stability.

Expression PLA2G2A has been extensively studied in human tissues where its activity is associated with inflammation, host defense against bacteria, blood coagulation and atherosclerosis. PLA2G2A is expressed in prostate epithelial cells, coronary vascular smooth muscle cells, kidney uriniferous tubular epithelium, respiratory epithelial cells, pulmonary arterial smooth muscle cells, placenta, hepatocytes, stomach, small and large intestine, spleen, thymus, tonsil, parotid and lacrine glands, cartilage and bone marrow, seminal plasma, tears, platelets, neutrophils, eosinophils, mast cells, macrophages, and liver Kupfer cells.
Many human cells can secrete PLA2G2A, including: mesangial cells, smooth muscle cells, endothelial cells, mast cells, neutrophils, macrophages, hepatic cells, platelets, Paneth cells, lacrimal cells, human tears, prostate cells, seminal plasma, chondrocytes, synoviocytes, and astrocytes.
PLA2G2A is constitutively expressed in: spleen, thymus, tonsil, bone marrow, intestine (Paneth cells), liver (Kupfer cells), neutrophils, macrophages, mast cells, and Platelets. In these last 4 cell types PLA2G2A is stored in granules and secreted following cell activation. PLA2G2A is induced by inflammatory cytokines such as IL-6, TNF-alpha and IL-8 in smooth muscle cells and hepatocytes, which may be the main source of PLA2G2A in systemic inflammatory conditions.
Function Overview: PLA2G2A is involved in arachidonic acid metabolism, production of lysophospholipid-derived mediators, antimicrobial activity, anticoagulation, exocytosis of endocrine cells, release of pro-inflammatory mediators, cell proliferation, ischemic injury and allergic disease, lipid modifications, and cancer. These functions are mediated by both enzyme catalytic and no-catalytic activities of PLA2G2A.

Phospholipase Catalytic activity. One important feature that discriminates PLA2G2A from other group II PLA2 family members is its highly cationic nature. PLA2G2A is highly basic with a pI of 9.4 and a net charge of +19; the positive charge is distributed over the surface of the protein and this permits the protein to bind anionic phospholipids, to bind tightly to anionic heparanoids such as heparin and heparan sulphate proteoglycans (HPSGs), and to form supra molecular aggregates, and in general PLA2G2A prefers substrates in aggregates (e.g., micelles). Thus, a large proportion of PLA2G2A protein will stick to cell surface molecules, as has been observed for recombinant PLA2 transfected into HEK293 cells. When bound to glycerophosphatidylinositol-anchored HSPGs such as glypicans, PLA2G2A is transferred to punctate compartments containing caveolin.
Substrate hydrolysis by PLA2G2A proceeds through activation and orientation of a water molecule by hydrogen bonding to the active site histidine. Adjacent to this histidine there is a conserved aspartate residue, which, together with the Ca2+-binding loop, acts as a ligand cage for Ca2+. The enzymatic reaction requires mM concentrations of Ca2+ and optimal substrate hydrolysis occurs at pH 7-9. PLA2G2A hydrolyzes the ester bond at the sn-2 position of glycerophospholipids with no strict fatty acid selectivity.
Enzymatically, the cationic nature of the PLA2G2A protein causes it to be much more effective in hydrolyzing fatty acids from negatively charged lipid membranes containing anionic phospholipids like phosphatidylserine (PS) than in releasing fatty acids from uncharged lipid membranes. The outer leaflets of unperturbed mammalian cells are characterized by neutral lipid composition enriched in phosphatidylcholines, sphingomyelin and cholesterol, thus unperturbed cells are poor substrates for extracellular PLA2G2A and thereby prevent indiscriminate hydrolysis of healthy cells. Consistent with this idea, healthy mammalian cells are highly resistant to exogenous PLA2G2A, requiring very high concentration of the protein to elicit arachidonic acid release. Perturbation of cell membranes by phospholipid scramblase that alters membrane symmetry increases PLA2G2A activity and arachidonic acid release. While PLA2G2A does not exhibit a strict selectivity for the types of fatty acids that are being released, arachidonic acid is certainly one of its major hydrolytic products. Arachidonic acid can be processed by cyclooxygenases (COX's) and lipoxygenases (LOX's) to form eicosanoids including prostaglandins and leukotrienes.
PLA2G2A activity is increased by association with the sulfated polysaccharides including heparanoids. In particular, arginine and lysine residues on the surface of PLA2G2A facilitates the binding of PLA2G2A to heparin and heparan sulfate proteoglycans. Under certain conditions sphingomyelin inhibits PLA2G2A enzyme activity. The high packing density of lipid bilayers rich in sphingomyelin hinders the penetration of PLA2G2A into the bilayer. Cholesterol counteracts the effect of sphingomyelin-based inhibition and enhances PLA2G2A hydrolysis. Ceramides also increase PLA2G2A activity and alter fatty acid specificity. Finally, the presence of oxidized phospholipids in vesicles facilitates PLA2G2A enzyme activity.

Arachidonic acid metabolism. While PLA2G2A is clearly implicated in arachidonic acid release its relative importance in this activity in specific cells and tissues is still under investigation. cPLA2alpha/IVA-PLA2 is considered to be the primary enzyme responsible for arachidonic acid release in many cells. In some cells IVA and PLA2G2A cooperate in arachidonic acid release and PGE2 production (e.g., as shown in rat gastric cells). In other cells PLA2G2A activity is dependent on the activity of cPLA2s. The reason that PLA2G2A is believed to be less of a key factor in arachidonic acid release is that PLA2G2A prefers to act on anionic phospholipids such as phosphatidyl glycerol, phosphatidyl ethanolamine and phosphatidyl serine in marked preference to charge neutral phospatidylcholine (PA>PE PS>PC). But the outer leaflet of mammalian cells (and in general the extracellular environment) is normally zwitterionic (containing unperturbed phosphatidyl choline bilayers), making these cells refractory to hydrolysis; traumatized, necrotic and apoptotic cells are more susceptible to hydrolysis by PLA2G2A, one reason that PLA2G2A has been proposed to play a role in apoptotic processes. PLA2G2A added exogenously is poorly capable of releasing arachidonic acid because PLA2G2A binds poorly to zwitterioninc phospatidylcholine on the outer leaflets of resting cells. PLA2G2A may release arachidonic acid from the membrane microdomains where cell activation-induced membrane rearrangements including altered phospholipid symmetry, phospholipid oxidation, altered membrane fluidity, and possible sphingomyelin turnover.

PLA2G2A is involved in Inflammation, an overview: PLA2G2A is induced during an inflammatory response by pro-inflammatory endotoxins and cytokines via both autocrine and paracrine processes and is involved in the acute phase of the immune responses. These stimuli can result from the action of microbial pathogens, chemical irritants, allergens and physical stress factors.PLA2G2A is an acute phase reactant and is found significantly increased in plasma in diseases that involve systemic inflammation such as sepsis, rheumatoid arthritis and cardiovascular diseases. For example, serum PLA2G2A concentrations can increase up to 1000 x fold in trauma and infection. Secreted PLA2G2A assists in the biosynthesis of lipid mediators in inflammatory cells such as mast cells, macrophages, neutrophils and eosinophils. Anti-inflammatory glucacorticoids are a potent suppressor of the induced expression of PLA2G2A. However, in certain contexts the actions of PLA2G2A may be anti-inflammatory. It plays a role in the removal of cell debris and micro particles resulting from tissue trauma and downstream lipid mediators such as prostaglandins may prevent chronic inflammation in tissues such as the gastrointestinal tract.

PLA2G2A, a pro-inflammatory factor. Since the identification of PLA2G2A from synovial fluid of patients with rheumatoid arthritis, high levels of PLA2G2A have been detected in many inflammatory, autoimmune, and allergic disease like acute pancreatitis, septic shock, adult respiratory distress syndrome, Crohn's disease, ulcerative colitis, bronchial asthma, and allergic rhinitis. Serum levels of PLA2G2A can serve as an index of disease activity in rheumatoid arthritis. Moreover, expression of PLA2G2A by inflammatory cells is induced by pro-inflammatory stimuli like LPS, TNF-alpha, IL-1beta, IL-6, and IFN-gamma, and strongly repressed by anti-inflammatory glucocorticoids, indicating that expression of PLA2G2A is strongly associated with, and regulated by inflammatory responses. The enzymatic activity of PLA2 enzymes results in the generation of bioactive molecules such as lysophospholipids and free fatty acids, of which the release of arachidonic acid is of particular interest because it is the first and rate-limiting step in the generation of eicosanoids. Free arachidonic acid is metabolized by COXs and LOXs into various prostaglandins and leukotrienes, respectively, bioactive molecules that have a wide range of effects, including modulation of inflammatory responses. Although cPLA2 enzymes have been implicated in the release of arachidonic acid specifically for eicosanoid generation, there is functional coupling between sPLA2s and cPLA2. PLA2G2A and sPLA2-V have been demonstrated to enhance eicosanoid generation, e.g., by stimulating expression of inducible COX-2 in conjunction with other stimuli. COX-2 (also known as prostaglandin H synthase-2) converts arachidonic acid to PGH2, the immediate substrate for a variety of prostaglandin and thromboxane synthases. In the GI tract, COX-2 is best known for its promotion of inflammation, proliferation of cancer cells and resistance to apoptosis. Although the mechanisms through which sPLA2s stimulate COX-2 induction have not been completely resolved, sPLA2-mediated generation of lysophosphatidylcholine (lyso-PC) may play a role in this process. In addition, lyso-PC has been demonstrated to be a chemoattractant for monocytes, suggesting that sPLA2s mediate the influx of inflammatory cells during inflammation. In rodents, Pla2g2a and several other sPLA2s can also function as ligands for PLA2-binding proteins like the M-type PLA2 receptor PLA2R1. This receptor is expressed by various inflammatory cells like neutrophils and macrophages. Stimulation of the PLA2R1 by sPLA2s induces activation of signal transduction pathways involving p38 MAPK, ERK1/ERK2, phosphatidylinositol 3-kinase (PI3K) and Akt, and results in the induction of iNOS and the production of various cytokines that mediate inflammatory responses against bacterial infections.
PLA2G2A is implicated in the development of inflammatory bowel disease (IBD) in both humans and rodents. In humans, its mRNA and protein expression is upregulated in both ulcerative colitis and Crohn's Disease, with an increase in expression detected in the colonic mucosa, in the intestinal submucosa in mast cells and macrophages, and in the serum of IBD patients. In rodents, inhibitors of Pla2g2a protect rats from TNBS-induced colitis; mouse Pla2g2a is upregulated in the colonic mucosa following treatment with azoxymethane and dextran sulfate sodium (DSS) and PLA2G2A is a candidate for a quantitative trait locus (QTL) for experimental IBD. All together, these data indicate that PLA2G2A modulates inflammatory responses by attracting inflammatory cells and by stimulating the production of various mediators of inflammation, both through its enzymatic and its receptor-mediated actions.

PLA2G2A, a potential anti-inflammatory factor. There is direct and indirect evidence that PLA2G2A may also act in an anti-inflammatory manner. Inbred strains of mice are naturally mutant or wildtype for the Pla2g2a allele. Several studies of gastric inflammation employing mice that expressed a wildtype allele of Pla2g2a, either as an endogenous copy or a transgene, clearly demonstrated that Pla2g2a+ mice were resistant to bacterially-induced gastric inflammation in comparison with C57BL/6 mice that expressed a mutant copy of Pla2g2a. In the DSS model of experimental IBD, C57BL/6 and Balb/c mice (Pla2g2a wildtype) were treated with DSS and it was observed that the C57BL/6 mice progressed to chronic inflammation while the Balb/c mice significantly upregulated production of PGE2, down-regulated expression of a great number of inflammatory cytokines and rapidly resolved the DSS-induced inflammation. This study indicated that PGE2 was protective against chronic inflammation, rather than a promoter of inflammation. Several other studies support this conclusion. DSS treatment of knockout mice that lack the EP4 PGE2 receptor caused a more severe colitis, greater mucosal damage, and enhanced proliferation of inflammatory CD4+ T cells when compared with EP4 wildtype mice. In rats, rectal injection of PGE2 following treatment with DSS caused the inhibition of tissue damage and the down-regulation of inflammatory cytokines. This finding was in agreement with the low levels of PGE2 observed upon enterocolitis relapse in the Lewis rat strain that is susceptible to relapse. PGE2 can also suppress Th1 cytokine production (IL-12, IFN-gamma) in intestinal macrophages, thereby helping to maintain resident macrophages in an anti-inflammatory mode. Indeed, COX-2 may have anti-inflammatory properties, and a number of studies suggest that inhibition of COX-2 and PGE2 can actually exacerbate IBD in mice. For example, in the IL-10 knockout model of colitis and inflammatory colon cancer, treatment of IL-10 knockout mice with the COX-2 selective inhibitors celecoxib and rofecoxib greatly increased the incidence of colitis. Thus, the specific context is a major determinant of whether a molecule acts in an inflammatory or anti-inflammatory fashion and this may be true for PGE2.
Normal bacterial flora play a key role in the development of colonic inflammation and inflammation-dependent and independent intestinal cancer, so it is quite likely that bactericidal factors such as PLA2G2A that are active in the intestinal crypt lumen may play an important role in management of gut flora, especially in the context of mucosal damage. Eicosanoids that are produced downstream of PLA2G2A are involved in both the initiation and resolution stages of inflammation and wound repair. This biphasic response involves multiple interacting factors that include PGE2, PGD2, PGJ2, plus the level of immune cell activation. This was demonstrated in a carrageenin-induced pleurisy model in rats where PLA2G2A was maximally produced in the resolution stage where it was associated with production of PGD2 and PGI2. PLA2G2A has been associated with upregulation of lipoxin A4, a suppressor of leukocyte function that reduces inflammation and leukocyte infiltration, and platelet activating factor (PAF), a molecule that enhances macrophage phagocytosis of apoptotic cells. Recent studies of sepsis also call into question a pro-inflammatory role for PLA2G2A. In human clinical trials, PLA2G2A inhibition produced a negative survival trend in sepsis patients. Sepsis has traditionally been treated as an inflammatory disease, but very recent work indicates that elevated levels of inflammatory cytokines actually improve clinical outcome. Consistent with this observation studies in rodent models of peritonitis showed that blockage of TNF-alpha resulted in a reduction in animal survival. Similarly, combination therapy against TNF-alpha and the IL-1 receptor was fatal in a rodent model of sepsis, an effect that was also observed in a clinical trial of TNF-alpha antagonists. Thus, the increased levels of PLA2G2A observed in some inflammatory conditions may result in enhanced destruction of invasive flora, and this may help resolve both the infection and inflammation. Consistent with this idea is the significant clinical improvement of sepsis patients treated with statins, a molecule that induces both PLA2G2A and pro-inflammatory cytokines. These data suggest that PLA2G2A can promote the resolution of inflammatory responses, thereby contributing to the prevention of chronic inflammation.

PLA2G2A has potent bactericidal activity. The management of normal enteric and infectious bacterial flora by PLA2G2A in prevention of inflammatory disease in both mice and humans is well-documented. PLA2G2A is stored in secretory granules of platelets, neutrophils, mast cells, gastric cells, goblet cells and Paneth cells, and is also expressed by macrophages. These types of cells have a common function in the defense against microbacteria. PLA2G2A is particularly active against Gram+ bacterial cells where it demonstrates a preference for the inner cell membrane. The positively charged residues on the surface of the PLA2G2A protein allow it to penetrate through the negatively charged cell wall of Gram-positive bacteria, where its enzymatic activity is responsible for membrane phospholipid degradation and ultimately bacterial killing. Overexpression of human PLA2G2A in transgenic mice resulted in decreased mortality in experimental Staphylococcus aureus infection and improved clearance of bacteria from organs and body fluids, and provided protection against Bacillus anthracis infection. Hence, enzymatic activity of PLA2G2A forms a first line of defense against Gram-positive bacteria such as Bacillus, Listeria, Staphylococcus, Streptococcus, Enterococcus, and Clostridium.
Gram-negative bacteria are coated with LPS. PLA2G2A exhibits only weak direct bactericidal activity against Gram-negative bacteria like Escherichia coli. Nevertheless, upon experimental E. coli infection, mice transgenic for wildtype Pla2g2a showed lower rates of mortality and less bacterial growth in tissues than their Pla2g2a-deficient C57BL/6 littermates, indicating that PLA2G2A does play a role in defense against Gram-negative bacteria. In humans, chronic gastritis caused by the Gram-negative bacterium Helicobacter pylori is a strong risk factor for gastric cancer where H. pylori has been shown to activate beta catenin. Human PLA2G2A is bactericidal against H. pylori in vitro but H. pylori's effect is modeled in vivo in the stomach of mice via the use of the related species H. felis. Infection of C57BL/6 mice with H. felis causes severe gastritis that eventually results in neoplastic development. A key early event in this gastritis is the breakdown of the epithelial phospholipid barrier. In several H. felis studies, comparison of inbred mouse strains that expressed either a wildtype or mutant allele of Pla2g2a indicated that expression of wildtype Pla2g2a provided resistance to both inflammation and neoplastic development. The protective role of PLA2G2A was further demonstrated by another study in which the expression of a human transgene in C57BL/6 mice prevented infection with H. felis. In another study, Balb/c mice that expressed a wildtype Pla2g2a gene were shown to sharply upregulate Pla2g2a in the stomach upon challenge with H. felis, resulting in rapid resolution of the inflammation. These effects of Pla2g2a on Gram-negative pathogens are probably due to receptor-mediated activity rather than to direct bactericidal activity. Knockout mice that lack the M-type PLA2 receptor Pla2r1 were demonstrated to be more resistant to LPS-induced endotoxic shock than their wild-type littermates. Hence, Pla2g2a and the PLA2R1 receptor are likely involved in the innate immune response against Gram-negative bacteria. Finally, in another study, C57BL/6-ApcMin/+ mice (Pla2g2a-negative) developed three-fold more colon tumors after infection with the naturally occurring Gram-negative bacterium Citrobacter rodentium. This study confirmed the oncogenic role of bacterial flora in colon carcinogenesis and emphasized the action of bactericidal agents such as Pla2g2a in management of gut flora to protect against tumorigenesis.

Catalytic-independent activity by PLA2G2A. Some biological effects of PLA2G2A are independent of its catalytic functions: catalytically inactive mutants can enhance COX-2 expression in connective tissue mast cells and catalytically inactive mutants can induce secretion of beta-glucuronidase, IL-6 and IL-8 from human eosinophils. Signaling mediated by binding to ανβ3 and α4β3 integrins stimulates proliferation of monocytes.
In rodents Pla2g2a binds to the 180 kDa M-type receptor, a cell surface protein that may be involved in important physiological functions that are mediated by the binding of PLA2's and other ligands. The M-type receptor is expressed in the colon, thus these receptors may have some importance in Pla2g2a's functions in intestinal tumorigenesis. Accordingly, there are reports that some functions of PLA2G2A do not rely on its hydrolytic activity, and that even arachidonic acid release can result solely from binding of PLA2G2A to its M-type cell surface receptor. Catalytically-inactive PLA2G2A mutants which were unable to cause the release of arachidonic acid from cytokine-primed mast cells still retained the ability to enhance COX-2 expression. Furthermore, the ability of PLA2G2A to enhance EGFR activation in A431 cells is located in a separate amino terminal domain from the distal phospholipase domain, although it is notable that other sPLA2's can inhibit EGF induced receptor activation in A431 cells. Other reported PLA2G2A activities that are likely to be independent of its enzymatic activity are the induction of iNOS in murine macrophages and the release of cytokines from human monocytes, lung macrophages and eosinophils.

PLA2G2A, arachidonic acid, and apoptosis. PLA2G2A has a preference for negatively charged lipid membranes containing anionic lipids like phosphatidylserine, due to its cationic nature. The outer leaflets of lipid bilayers in unperturbed cells have a neutral lipid composition enriched in phosphatidylcholines, sphingomyelin, and cholesterol, and form a poor substrate for PLA2G2A. However, cells that are undergoing apoptosis lose their membrane asymmetry, resulting in exposure of anionic lipids to the outer leaflet, thereby increasing the affinity for PLA2G2A binding. Moreover, perturbed cell membranes are also found in cancer cells. Apoptosis of transformed cancer cells is an important defense mechanism against neoplastic development, and PLA2 enzymes both promote and prevent apoptosis in different cell types under different pathological conditions. Addition of phospholipid scramblase, an enzyme that alters membrane symmetry, to HEK293 cells, caused an increase in PLA2G2A activity, resulting in an increase in arachidonic acid release and a slowing in cellular proliferation. Arachidonic acid produced by PLA2G2A enzymatic activity promotes apoptosis in colon cancer cells and in many other types of normal and cancer cells. Exogenous arachidonic acid is cytotoxic to HCT-116 colon cancer cells and causes an increase in the expression of pro-apoptotic genes such as caspase-3 and c-Jun and a decrease in the expression of genes that promote cancer cell survival. In another study, exogenous arachidonic acid caused a dramatic increase in rates of apoptosis in HCT-116 and SW480 colon cancer cells, a phenotype that was associated with the activation of neutral sphingomyelinase resulting in the greatly enhanced production of ceramide. Sphingomyelinases and their sphingolipid products confer resistance to colon cancer, including the suppression of tumorigenesis in ApcMin/+ mice. Sphingomyelin in the outer leaflet of healthy cells is not a substrate for PLA2G2A and inhibits its activity. It is possible that sphingomyelinase may stimulate PLA2G2A by the removal of inhibitory sphingomyelins. It has been reported that TNF-alpha induces sphingomyelinase hydrolysis, resulting in PLA2G2A activation and arachidonic acid release. Cytosolic PLA2's resistance to AOM-induced colon tumors was associated with a sharp increase in ceramide production in cPLA2 wildtype mice versus knockout mice. A similar mechanism may contribute to PLA2G2A's mode of action as has been shown with other sPLA2's. Interestingly, factors that promote release of arachidonic acid from cells, such as Vitamin D3 and other nuclear receptor agonists promote apoptosis despite the concurrent increase in lipoxygenases. PLA2G2A also induces apoptosis in a wide range of non-colonic cells including neurons, astrocytes, fibroblasts, murine macrophages and NK and cytotoxic T cells. Finally, while PGE2 is generally considered as a pro-cell-survival factor, it does induce apoptosis in certain cell types such as brain glial cells where PGE2 activates BAX.

PLA2G2A receptors. In mice and rabbits PLA2G2A binds to a 180 kDa M-type high affinity receptor but no receptor has been identified in humans. Binding to this receptor in mice induces Pla2g2a internalization. Human PLA2G2A has been shown to bind to integrins (such as ανβ3 and α4β3), and to heparan sulfate proteoglycans such as glypican 1 and decorin.

Inducers and downstream effectors of sPLA2-IIA. Factors that stimulate PLA2G2A include bacterial lipopolysaccarides (LPS), interleukin (IL)-1beta, IL-6, IL-8, tumor necrosis factor (TNF)-alpha, interferon (IFN)-gamma, phorbol esters, and cyclic AMP (cAMP) elevating agents. The PLA2G2A promoter has TATA and CAAT boxes and binding sites for AP-1, C/EBPs, CREB, NF-kappaB, STAT, PPAR-gamma, LXR/RXR heterodimers and NFATs. In some contexts PLA2G2A activation is dependent upon prior activation by cPLA2 and 12-LOX/15-LOX. Factors that inhibit PLA2G2A include TGF-beta, IL-10, epidermal growth factor (EGF), basic fibroblast growth factor (bFGF), platelet derived growth factor (PDGF) and insulin growth factor (IGF). Some of the molecules and pathways that act downstream of PLA2G2A include ERK1/2, inducible nitric oxide synthase (iNOS) in RAW264.7 macrophages, EGF, based on its ability to increase activation of EGF receptor (EGFR) in A431 cells, MUC16 in human conjunctive epithelium, and in human microvascular cells PLA2G2A induces NF-kappaB, intercellular adhesion molecule (ICAM)-1, IL-8, epithelial derived neutrophil activating peptide (ENA)-78/CXCL5 and growth regulated protein Gro-alpha/CXCL1.

Homology PLA2G2A is conserved in mice, rats, chimpanzees, cows and chickens.

Mutations

Somatic 1 mutation listed: a small deletion in codon 47 of NM_000300.2 (HGMD).

Implicated in

Note
  
Entity Gastric cancer
Note PLA2G2A expression is positively associated with resistance to human gastric cancer progression. PLA2G2A is a direct target of Wnt/beta catenin signaling in human gastric cancer; its expression is silenced by hypermethylation of promoter elements that contain beta catenin target sites; expression of PLA2G2A suppressed gastric cancer migration and invasion in cell culture and this phenotype was mediated by the inhibition of S100A4 and NEDD9; hemizygous gene deletions were found in at least two human gastric cancer cell lines.
  
  
Entity Colorectal cancer
Note The role of PLA2G2a in human colorectal cancer is unclear. In one study, expression of PLA2G2A was found to decline with cancer progression. Other studies have found that PLA2G2A is upregulated in human colon adenomas; that expression of PLA2G2A is associated with shorter disease free survival; that PLA2G2A is upregulated in MSI+ colorectal cancers but down-regulated in APC-dependent colorectal cancers; and another study found that PLA2G2A is highly expressed in normal colon mucosa but its expression did not vary in adenocarcinomas. With the exception of a single European family, there are no reports of mutations in PLA2G2A that are implicated in differential risk for familial colorectal cancer. However, PLA2G2A lies in a region of chromosome one that is frequently subject to LOH in a variety of human epithelial cancers, including colorectal cancers. Mouse strains that are naturally mutant for a truncation mutation that eliminates the Pla2g2a catalytic region in the protein (e.g., C57BL/6) are susceptible to intestinal tumorigenesis, compared with strains that express a wildtype Pla2g2a allele. Introduction of a wildtype Pla2g2a transgene into the susceptible C57BL/6 strain caused a significant reduction in tumor multiplicity, tumor size and progression in several mouse models of intestinal cancer, including ApcMin/+ mice, Muc2 knockout mice and mice treated with azoxymethane.
  
  
Entity Pancreatic cancer
Note Upregulation of PLA2G2A is associated with better prognosis.
  
  
Entity Prostate cancer
Note There is one report showing that expression of PLA2G2A is downregulated in metastatic human prostate cancer. However, many more groups have reported that expression of PLA2G2A is upregulated at all stages of prostate cancer with one report indicating that its upregulation may be androgen inducible.
  
  
Entity Ovarian cancer
Note PLA2G2A is decreased in ovarian cancer following chemotherapy.
  
  
Entity Breast cancer
Note Aberrant expression of PLA2G2A has been reported in breast cancer.
  
  
Entity Familial adenomatous polyposis (FAP)
Note PLA2G2A is reported to be a modifier for fundic gland polyposis in FAP patients.
  
  
Entity Gastric gland metaplasia
Note Increased levels of PLA2G2A are associated with gastric gland metaplasia.
  
  
Entity Inflammation
Note Upregulation of PLA2G2A is associated with a variety of inflammatory conditions. For example, large amounts of PLA2G2A is detected in exudating fluids and plasma of patients with various systemic and local inflammatory diseases such as Crohn's disease, ulcerative colitis, sepsis, psoriasis, arthritis, respiratory distress syndrome, and asthma. While the predominance of evidence links PLA2G2A to the promotion of inflammation, there is also some evidence that PLA2G2A, in some specific contexts, may exert anti-inflammatory actions, such as by its management of flora, its involvement in removal of cell debris and micro particles resulting from tissue trauma, and by production of anti-inflammatory lipid mediators, including a variety of eicosanoids.
  
  
Entity Atherosclerosis
Note PLA2G2A expression is increased in atherosclerotic lesions and its expression is associated with a decrease in levels of high density lipoprotein and in one report expression of PLA2G2A in macrophages is proposed to be the source of the upregulation. PLA2G2A can also modify LDL leading to more pronounced lipid accumulation in the vessel wall.
  
  
Entity Acute myocardial infarction
Note Increased levels of PLA2G2A are reported following these events.
  
  
Entity Renal infarction
Note Increased levels of PLA2G2A are reported in infracted kidneys, in the uriniferoustubular epithelium.
  
  
Entity Viral hepatitis
Note Levels of PLA2G2A are increased in hepatocytes with fatty degeneration associated with viral hepatitis C.
  
  
Entity Ischemia
Note PLA2G2A-induced changes in phospholipid integrity and toxic actions of free fatty acids and lysophospolipids may be critical for altered plasma membrane and mitochondrial permeability properties associated with ischemia and perfusion.
  
  
Entity Coronary heart disease
Note An increase in circulating PLA2G2A is associated with unstable angina and is considered a risk factor for cardiovascular disease; PLA2G2A is increased in infarcted tissues and severely damaged cardiomyocytes.
  
  
Entity Lung disorders
Note Expression of PLA2G2A is increased in patients with cystic fibrosis; PLA2G2A is expressed by alveolar macrophages.
  
  
Entity Brain disorders
Note Dysregulation of PLA2G2A is associated with Alzheimer disease, stroke, oxidative pathways in astrocytes and cortical neurons, apoptosis in neurons.
  
  
Entity Other disorders
Note Aberrant expression of PLA2G2A has been reported in glaucoma, pancreatitis, schizophrenia, affective disorder, diabetes.
  

Bibliography

Topological and functional discovery in a gene coexpression meta-network of gastric cancer.
Aggarwal A, Guo DL, Hoshida Y, Yuen ST, Chu KM, So S, Boussioutas A, Chen X, Bowtell D, Aburatani H, Leung SY, Tan P.
Cancer Res. 2006 Jan 1;66(1):232-41.
PMID 16397236
 
Transcriptional regulation of inflammatory secreted phospholipases A(2).AUTHORS
Andreani M, Olivier JL, Berenbaum F, Raymondjean M, Bereziat G.
Biochim Biophys Acta. 2000 Oct 31;1488(1-2):149-58.
PMID 11080684
 
The antibacterial properties of secreted phospholipases A2: a major physiological role for the group IIA enzyme that depends on the very high pI of the enzyme to allow penetration of the bacterial cell wall.
Beers SA, Buckland AG, Koduri RS, Cho W, Gelb MH, Wilton DC.
J Biol Chem. 2002 Jan 18;277(3):1788-93. Epub 2001 Nov 12.
PMID 11706041
 
Expression of secretory phospholipase A2 in colon tumor cells potentiates tumor growth.
Belinsky GS, Rajan TV, Saria EA, Giardina C, Rosenberg DW.
Mol Carcinog. 2007 Feb;46(2):106-16.
PMID 17091473
 
Type IIA secretory phospholipase A2 up-regulates cyclooxygenase-2 and amplifies cytokine-mediated prostaglandin production in human rheumatoid synoviocytes.
Bidgood MJ, Jamal OS, Cunningham AM, Brooks PM, Scott KF.
J Immunol. 2000 Sep 1;165(5):2790-7.
PMID 10946311
 
Catalytic and non-catalytic functions of human IIA phospholipase A2.
Birts CN, Barton CH, Wilton DC.
Trends Biochem Sci. 2010 Jan;35(1):28-35. Epub 2009 Oct 8. (REVIEW)
PMID 19818633
 
The antibacterial properties of secreted phospholipases A(2).
Buckland AG, Wilton DC.
Biochim Biophys Acta. 2000 Oct 31;1488(1-2):71-82.
PMID 11080678
 
The Mom1AKR intestinal tumor resistance region consists of Pla2g2a and a locus distal to D4Mit64.
Cormier RT, Bilger A, Lillich AJ, Halberg RB, Hong KH, Gould KA, Borenstein N, Lander ES, Dove WF.
Oncogene. 2000 Jun 29;19(28):3182-92.
PMID 10918573
 
Apoptosis-inducing factor of a cytotoxic T cell line: involvement of a secretory phospholipase A2.
Costa-Junior HM, Hamaty FC, da Silva Farias R, Einicker-Lamas M, da Silva MH, Persechini PM.
Cell Tissue Res. 2006 May;324(2):255-66. Epub 2006 Jan 27.
PMID 16609916
 
Diversity of group types, regulation, and function of phospholipase A2.
Dennis EA.
J Biol Chem. 1994 May 6;269(18):13057-60.
PMID 8175726
 
The intestinal epithelium and its neoplasms: genetic, cellular and tissue interactions.
Dove WF, Cormier RT, Gould KA, Halberg RB, Merritt AJ, Newton MA, Shoemaker AR.
Philos Trans R Soc Lond B Biol Sci. 1998 Jun 29;353(1370):915-23. (REVIEW)
PMID 9684289
 
Pla2g2a attenuates colon tumorigenesis in azoxymethane-treated C57BL/6 mice; expression studies reveal Pla2g2a target genes and pathways.
Fijneman RJ, Bade LK, Peham JR, van de Wiel MA, van Hinsbergh VW, Meijer GA, O'Sullivan MG, Cormier RT.
Cell Oncol. 2009;31(5):345-56.
PMID 19759415
 
Inhibition of gastric cancer invasion and metastasis by PLA2G2A, a novel beta-catenin/TCF target gene.
Ganesan K, Ivanova T, Wu Y, Rajasegaran V, Wu J, Lee MH, Yu K, Rha SY, Chung HC, Ylstra B, Meijer G, Lian KO, Grabsch H, Tan P.
Cancer Res. 2008 Jun 1;68(11):4277-86.
PMID 18519687
 
Expression of group IIa secretory phospholipase A2 increases with prostate tumor grade.
Graff JR, Konicek BW, Deddens JA, Chedid M, Hurst BM, Colligan B, Neubauer BL, Carter HW, Carter JH.
Clin Cancer Res. 2001 Dec;7(12):3857-61.
PMID 11751475
 
Secretory phospholipases A2 as multivalent mediators of inflammatory and allergic disorders.
Granata F, Balestrieri B, Petraroli A, Giannattasio G, Marone G, Triggiani M.
Int Arch Allergy Immunol. 2003 Jul;131(3):153-63. (REVIEW)
PMID 12876405
 
Bactericidal properties of group IIA and group V phospholipases A2.
Gronroos JO, Laine VJ, Janssen MJ, Egmond MR, Nevalainen TJ.
J Immunol. 2001 Mar 15;166(6):4029-34.
PMID 11238650
 
Phospholipase A2 in serum and colonic mucosa in ulcerative colitis.
Haapamaki MM, Gronroos JM, Nurmi H, Irjala K, Alanen KA, Nevalainen TJ.
Scand J Clin Lab Invest. 1999 Jul;59(4):279-87.
PMID 10463466
 
Resistance to endotoxic shock in phospholipase A2 receptor-deficient mice.
Hanasaki K, Yokota Y, Ishizaki J, Itoh T, Arita H.
J Biol Chem. 1997 Dec 26;272(52):32792-7.
PMID 9407054
 
Bactericidal properties of murine intestinal phospholipase A2.
Harwig SS, Tan L, Qu XD, Cho Y, Eisenhauer PB, Lehrer RI.
J Clin Invest. 1995 Feb;95(2):603-10.
PMID 7860744
 
Helicobacter pylori and gastric cancer: a new paradigm for inflammation-associated epithelial cancers.
Houghton J, Wang TC.
Gastroenterology. 2005 May;128(6):1567-78.
PMID 15887152
 
Antibacterial effects of human group IIA and group XIIA phospholipase A2 against Helicobacter pylori in vitro.
Huhtinen HT, Gronroos JO, Gronroos JM, Uksila J, Gelb MH, Nevalainen TJ, Laine VJ.
APMIS. 2006 Feb;114(2):127-30.
PMID 16519749
 
Expression of group IIA secretory phospholipase A2 is elevated in prostatic intraepithelial neoplasia and adenocarcinoma.
Jiang J, Neubauer BL, Graff JR, Chedid M, Thomas JE, Roehm NW, Zhang S, Eckert GJ, Koch MO, Eble JN, Cheng L.
Am J Pathol. 2002 Feb;160(2):667-71.
PMID 11839587
 
Localization and evolution of two human phospholipase A2 genes and two related genetic elements.
Johnson LK, Frank S, Vades P, Pruzanski W, Lusis AJ, Seilhamer JJ.
Adv Exp Med Biol. 1990;275:17-34.
PMID 2239445
 
Enhancing activity and phospholipase A2 activity: two independent activities present in the enhancing factor molecule.
Kadam S, Mulherkar R.
Biochem J. 1999 May 15;340 ( Pt 1):237-43.
PMID 10229680
 
Overexpression of the nonpancreatic secretory group II PLA2 messenger RNA and protein in colorectal adenomas from familial adenomatous polyposis patients.
Kennedy BP, Soravia C, Moffat J, Xia L, Hiruki T, Collins S, Gallinger S, Bapat B.
Cancer Res. 1998 Feb 1;58(3):500-3.
PMID 9458096
 
Different gene expression profiles between microsatellite instability-high and microsatellite stable colorectal carcinomas.
Kim H, Nam SW, Rhee H, Shan Li L, Ju Kang H, Hye Koh K, Kyu Kim N, Song J, Tak-Bun Liu E, Kim H.
Oncogene. 2004 Aug 19;23(37):6218-25
PMID 15208663
 
Comparison of the activities of wild type and mutant enhancing factor/mouse secretory phospholipase A2 proteins.
Kirtane BM, Mulherkar R.
J Biosci. 2002 Sep;27(5):489-94.
PMID 12381872
 
Role of type IIA secretory phospholipase A2 in arachidonic acid metabolism.
Kuwata H, Sawada H, Murakami M, Kudo I.
Adv Exp Med Biol. 1999;469:183-8.
PMID 10667329
 
Type IIA secretory PLA2-mediated delayed PGE2 biosynthesis is regulated by the products of the cytosolic PLA2.
Kuwata H, Yamamoto S, Nakatani Y, Murakami M, Kudo I.
Adv Exp Med Biol. 2002;507:9-13.
PMID 12664557
 
Resistance of transgenic mice expressing human group II phospholipase A2 to Escherichia coli infection.
Laine VJ, Grass DS, Nevalainen TJ.
Infect Immun. 2000 Jan;68(1):87-92.
PMID 10603372
 
Secretory phospholipase A2 induces apoptosis through TNF-alpha and cytochrome c-mediated caspase cascade in murine macrophage RAW 264.7 cells.
Lee C, Park DW, Lee J, Lee TI, Kim YJ, Lee YS, Baek SH.
Eur J Pharmacol. 2006 Apr 24;536(1-2):47-53. Epub 2006 Feb 28.
PMID 16564042
 
Domain-induced activation of human phospholipase A2 type IIA: local versus global lipid composition.
Leidy C, Linderoth L, Andresen TL, Mouritsen OG, Jorgensen K, Peters GH.
Biophys J. 2006 May 1;90(9):3165-75. Epub 2006 Feb 3.
PMID 16461407
 
Phospholipase A2 group IIA expression in gastric adenocarcinoma is associated with prolonged survival and less frequent metastasis.
Leung SY, Chen X, Chu KM, Yuen ST, Mathy J, Ji J, Chan AS, Li R, Law S, Troyanskaya OG, Tu IP, Wong J, So S, Botstein D, Brown PO.
Proc Natl Acad Sci U S A. 2002 Dec 10;99(25):16203-8. Epub 2002 Nov 27.
PMID 12456890
 
Secretory phospholipase A2 as an index of disease activity in rheumatoid arthritis. Prospective double blind study of 212 patients.
Lin MK, Farewell V, Vadas P, Bookman AA, Keystone EC, Pruzanski W.
J Rheumatol. 1996 Jul;23(7):1162-6.
PMID 8823686
 
Diversity in secreted PLA2-IIA activity among inbred mouse strains that are resistant or susceptible to Apc Min/+ tumorigenesis.
Markova M, Koratkar RA, Silverman KA, Sollars VE, MacPhee-Pellini M, Walters R, Palazzo JP, Buchberg AM, Siracusa LD, Farber SA.
Oncogene. 2005 Sep 22;24(42):6450-8.
PMID 16007193
 
Diverse cellular localizations of secretory phospholipase A2 enzymes in several human tissues.
Masuda S, Murakami M, Ishikawa Y, Ishii T, Kudo I.
Biochim Biophys Acta. 2005 Oct 1;1736(3):200-10. Epub 2005 Sep 7.
PMID 16188494
 
Local production of chemokines and prostaglandin E2 in the acute, chronic and recovery phase of murine experimental colitis.
Melgar S, Drmotova M, Rehnstrom E, Jansson L, Michaelsson E.
Cytokine. 2006 Sep;35(5-6):275-83. Epub 2006 Nov 7.
PMID 17088072
 
Involvement of epigenetic mechanisms in the regulation of secreted phospholipase A2 expressions in Jurkat leukemia cells.
Menschikowski M, Hagelgans A, Kostka H, Eisenhofer G, Siegert G.
Neoplasia. 2008 Nov;10(11):1195-203.
PMID 18953428
 
Enhancing factor, a Paneth cell specific protein from mouse small intestines: predicted amino acid sequence from RT-PCR amplified cDNA and its expression.
Mulherkar R, Rao RS, Wagle AS, Patki V, Deo MG.
Biochem Biophys Res Commun. 1993 Nov 30;197(1):351-2.
PMID 8250944
 
Secretory phospholipase A2.
Murakami M, Kudo I.
Biol Pharm Bull. 2004 Aug;27(8):1158-64. (REVIEW)
PMID 15305013
 
Hot topics in phospholipase A2 field.
Murakami M.
Biol Pharm Bull. 2004 Aug;27(8):1179-82. (REVIEW)
PMID 15305017
 
Loss of the PLA2G2A gene in a sporadic colorectal tumor of a patient with a PLA2G2A germline mutation and absence of PLA2G2A germline alterations in patients with FAP.
Nimmrich I, Friedl W, Kruse R, Pietsch S, Hentsch S, Deuter R, Winde G, Muller O.
Hum Genet. 1997 Sep;100(3-4):345-9.
PMID 9272153
 
Helicobacter infection and phospholipase A2 enzymes: effect of Helicobacter felis-infection on the expression and activity of sPLA2 enzymes in mouse stomach.
Ottlecz A, Romero JJ, Lichtenberger LM.
Mol Cell Biochem. 2001 May;221(1-2):71-7.
PMID 11506189
 
In vivo protective role of human group IIa phospholipase A2 against experimental anthrax.
Piris-Gimenez A, Paya M, Lambeau G, Chignard M, Mock M, Touqui L, Goossens PL.
J Immunol. 2005 Nov 15;175(10):6786-91.
PMID 16272335
 
Evidence for the regulatory role of the N-terminal helix of secretory phospholipase A(2) from studies on native and chimeric proteins.
Qin S, Pande AH, Nemec KN, He X, Tatulian SA.
J Biol Chem. 2005 Nov 4;280(44):36773-83. Epub 2005 Aug 15.
PMID 16103116
 
Analysis of the secretory phospholipase A2 that mediates prostaglandin production in mast cells.
Reddy ST, Winstead MV, Tischfield JA, Herschman HR.
J Biol Chem. 1997 May 23;272(21):13591-6.
PMID 9153207
 
The phospholipase A2 superfamily and its group numbering system.
Schaloske RH, Dennis EA.
Biochim Biophys Acta. 2006 Nov;1761(11):1246-59. Epub 2006 Aug 3. (REVIEW)
PMID 16973413
 
Cloning and recombinant expression of phospholipase A2 present in rheumatoid arthritic synovial fluid.
Seilhamer JJ, Pruzanski W, Vadas P, Plant S, Miller JA, Kloss J, Johnson LK.
J Biol Chem. 1989 Apr 5;264(10):5335-8.
PMID 2925608
 
Oncogenic action of secreted phospholipase A2 in prostate cancer.
Sved P, Scott KF, McLeod D, King NJ, Singh J, Tsatralis T, Nikolov B, Boulas J, Nallan L, Gelb MH, Sajinovic M, Graham GG, Russell PJ, Dong Q.
Cancer Res. 2004 Oct 1;64(19):6934-40.
PMID 15466184
 
Low-molecular-weight, calcium-dependent phospholipase A2 genes are linked and map to homologous chromosome regions in mouse and human.
Tischfield JA, Xia YR, Shih DM, Klisak I, Chen J, Engle SJ, Siakotos AN, Winstead MV, Seilhamer JJ, Allamand V, Gyapay G, Lusis AJ.
Genomics. 1996 Mar 15;32(3):328-33.
PMID 8838795
 
Activation of human inflammatory cells by secreted phospholipases A2.
Triggiani M, Granata F, Frattini A, Marone G.
Biochim Biophys Acta. 2006 Nov;1761(11):1289-300. Epub 2006 Jul 21.
PMID 16952481
 
Mice lacking secretory phospholipase A2 show altered apoptosis and differentiation with Helicobacter felis infection.
Wang TC, Goldenring JR, Dangler C, Ito S, Mueller A, Jeon WK, Koh TJ, Fox JG.
Gastroenterology. 1998 Apr;114(4):675-89.
PMID 9516388
 
The potent anti-Staphylococcus aureus activity of a sterile rabbit inflammatory fluid is due to a 14-kD phospholipase A2.
Weinrauch Y, Elsbach P, Madsen LM, Foreman A, Weiss J.
J Clin Invest. 1996 Jan 1;97(1):250-7.
PMID 8550843
 
COX-2, inflammatory secreted PLA2, and cytoplasmic PLA2 protein expression in small bowel adenocarcinomas compared with colorectal adenocarcinomas.
Wendum D, Svrcek M, Rigau V, Boelle PY, Sebbagh N, Parc R, Masliah J, Trugnan G, Flejou JF.
Mod Pathol. 2003 Feb;16(2):130-6.
PMID 12591965
 
A potent and selective inhibitor of group IIa secretory phospholipase A2 protects rats from TNBS-induced colitis.
Woodruff TM, Arumugam TV, Shiels IA, Newman ML, Ross PA, Reid RC, Fairlie DP, Taylor SM.
Int Immunopharmacol. 2005 May;5(5):883-92.
PMID 15778124
 
Tagging-SNP haplotype analysis of the secretory PLA2IIa gene PLA2G2A shows strong association with serum levels of sPLA2IIa: results from the UDACS study.
Wootton PT, Drenos F, Cooper JA, Thompson SR, Stephens JW, Hurt-Camejo E, Wiklund O, Humphries SE, Talmud PJ.
Hum Mol Genet. 2006 Jan 15;15(2):355-61. Epub 2005 Dec 20.
PMID 16368710
 
Interaction of Muc2 and Apc on Wnt signaling and in intestinal tumorigenesis: potential role of chronic inflammation.
Yang K, Popova NV, Yang WC, Lozonschi I, Tadesse S, Kent S, Bancroft L, Matise I, Cormier RT, Scherer SJ, Edelmann W, Lipkin M, Augenlicht L, Velcich A.
Cancer Res. 2008 Sep 15;68(18):7313-22.
PMID 18794118
 
Delayed oxidant-induced cell death involves activation of phospholipase A2.
Zhao M, Brunk UT, Eaton JW.
FEBS Lett. 2001 Dec 14;509(3):399-404.
PMID 11749963
 
Cd14, Gbp1, and Pla2g2a: three major candidate genes for experimental IBD identified by combining QTL and microarray analyses.
de Buhr MF, Mahler M, Geffers R, Hansen W, Westendorf AM, Lauber J, Buer J, Schlegelberger B, Hedrich HJ, Bleich A.
Physiol Genomics. 2006 May 16;25(3):426-34.
PMID 16705022
 

Citation

This paper should be referenced as such :
Cormier, RT
PLA2G2A (phospholipase A2, group IIA (platelets, synovial fluid))
Atlas Genet Cytogenet Oncol Haematol. 2011;15(2):198-207.
Free journal version : [ pdf ]   [ DOI ]
On line version : http://AtlasGeneticsOncology.org/Genes/PLA2G2AID41730ch1p36.html


External links

Nomenclature
HGNC (Hugo)PLA2G2A   9031
Cards
AtlasPLA2G2AID41730ch1p36
Entrez_Gene (NCBI)PLA2G2A  5320  phospholipase A2 group IIA
AliasesMOM1; PLA2; PLA2B; PLA2L; 
PLA2S; PLAS1; sPLA2
GeneCards (Weizmann)PLA2G2A
Ensembl hg19 (Hinxton)ENSG00000188257 [Gene_View]  chr1:20301924-20306932 [Contig_View]  PLA2G2A [Vega]
Ensembl hg38 (Hinxton)ENSG00000188257 [Gene_View]  chr1:20301924-20306932 [Contig_View]  PLA2G2A [Vega]
ICGC DataPortalENSG00000188257
TCGA cBioPortalPLA2G2A
AceView (NCBI)PLA2G2A
Genatlas (Paris)PLA2G2A
WikiGenes5320
SOURCE (Princeton)PLA2G2A
Genetics Home Reference (NIH)PLA2G2A
Genomic and cartography
GoldenPath hg19 (UCSC)PLA2G2A  -     chr1:20301924-20306932 -  1p35   [Description]    (hg19-Feb_2009)
GoldenPath hg38 (UCSC)PLA2G2A  -     1p35   [Description]    (hg38-Dec_2013)
EnsemblPLA2G2A - 1p35 [CytoView hg19]  PLA2G2A - 1p35 [CytoView hg38]
Mapping of homologs : NCBIPLA2G2A [Mapview hg19]  PLA2G2A [Mapview hg38]
OMIM172411   
Gene and transcription
Genbank (Entrez)AK291302 AM393490 AY656695 AY656696 BC005919
RefSeq transcript (Entrez)NM_000300 NM_001161727 NM_001161728 NM_001161729
RefSeq genomic (Entrez)NC_000001 NC_018912 NG_012928 NT_032977 NW_004929289
Consensus coding sequences : CCDS (NCBI)PLA2G2A
Cluster EST : UnigeneHs.466804 [ NCBI ]
CGAP (NCI)Hs.466804
Alternative Splicing GalleryENSG00000188257
Gene ExpressionPLA2G2A [ NCBI-GEO ]   PLA2G2A [ EBI - ARRAY_EXPRESS ]   PLA2G2A [ SEEK ]   PLA2G2A [ MEM ]
Gene Expression Viewer (FireBrowse)PLA2G2A [ Firebrowse - Broad ]
SOURCE (Princeton)Expression in : [Datasets]   [Normal Tissue Atlas]  [carcinoma Classsification]  [NCI60]
GenevisibleExpression in : [tissues]  [cell-lines]  [cancer]  [perturbations]  
BioGPS (Tissue expression)5320
GTEX Portal (Tissue expression)PLA2G2A
Protein : pattern, domain, 3D structure
UniProt/SwissProtP14555   [function]  [subcellular_location]  [family_and_domains]  [pathology_and_biotech]  [ptm_processing]  [expression]  [interaction]
NextProtP14555  [Sequence]  [Exons]  [Medical]  [Publications]
With graphics : InterProP14555
Splice isoforms : SwissVarP14555
Catalytic activity : Enzyme3.1.1.4 [ Enzyme-Expasy ]   3.1.1.43.1.1.4 [ IntEnz-EBI ]   3.1.1.4 [ BRENDA ]   3.1.1.4 [ KEGG ]   
PhosPhoSitePlusP14555
Domaine pattern : Prosite (Expaxy)PA2_ASP (PS00119)    PA2_HIS (PS00118)   
Domains : Interpro (EBI)PLipase_A2    PLipase_A2_Asp_AS    PLipase_A2_dom    PLipase_A2_His_AS   
Domain families : Pfam (Sanger)Phospholip_A2_1 (PF00068)   
Domain families : Pfam (NCBI)pfam00068   
Domain families : Smart (EMBL)PA2c (SM00085)  
Conserved Domain (NCBI)PLA2G2A
DMDM Disease mutations5320
Blocks (Seattle)PLA2G2A
PDB (SRS)1AYP    1BBC    1DB4    1DB5    1DCY    1J1A    1KQU    1KVO    1N28    1N29    1POD    1POE    2GNY    3U8B    3U8D    3U8H    3U8I   
PDB (PDBSum)1AYP    1BBC    1DB4    1DB5    1DCY    1J1A    1KQU    1KVO    1N28    1N29    1POD    1POE    2GNY    3U8B    3U8D    3U8H    3U8I   
PDB (IMB)1AYP    1BBC    1DB4    1DB5    1DCY    1J1A    1KQU    1KVO    1N28    1N29    1POD    1POE    2GNY    3U8B    3U8D    3U8H    3U8I   
PDB (RSDB)1AYP    1BBC    1DB4    1DB5    1DCY    1J1A    1KQU    1KVO    1N28    1N29    1POD    1POE    2GNY    3U8B    3U8D    3U8H    3U8I   
Structural Biology KnowledgeBase1AYP    1BBC    1DB4    1DB5    1DCY    1J1A    1KQU    1KVO    1N28    1N29    1POD    1POE    2GNY    3U8B    3U8D    3U8H    3U8I   
SCOP (Structural Classification of Proteins)1AYP    1BBC    1DB4    1DB5    1DCY    1J1A    1KQU    1KVO    1N28    1N29    1POD    1POE    2GNY    3U8B    3U8D    3U8H    3U8I   
CATH (Classification of proteins structures)1AYP    1BBC    1DB4    1DB5    1DCY    1J1A    1KQU    1KVO    1N28    1N29    1POD    1POE    2GNY    3U8B    3U8D    3U8H    3U8I   
SuperfamilyP14555
Human Protein AtlasENSG00000188257
Peptide AtlasP14555
HPRD01397
IPIIPI00026962   
Protein Interaction databases
DIP (DOE-UCLA)P14555
IntAct (EBI)P14555
FunCoupENSG00000188257
BioGRIDPLA2G2A
STRING (EMBL)PLA2G2A
ZODIACPLA2G2A
Ontologies - Pathways
QuickGOP14555
Ontology : AmiGOphospholipase A2 activity  phospholipase A2 activity  calcium ion binding  phospholipid binding  extracellular region  extracellular space  endoplasmic reticulum  endoplasmic reticulum membrane  phospholipid metabolic process  phosphatidic acid biosynthetic process  positive regulation of macrophage derived foam cell differentiation  lipid catabolic process  secretory granule  low-density lipoprotein particle remodeling  phosphatidylglycerol acyl-chain remodeling  phosphatidylinositol acyl-chain remodeling  phosphatidylserine acyl-chain remodeling  phosphatidylcholine acyl-chain remodeling  phosphatidylethanolamine acyl-chain remodeling  phosphatidic acid metabolic process  calcium-dependent phospholipase A2 activity  perinuclear region of cytoplasm  positive regulation of inflammatory response  defense response to Gram-positive bacterium  extracellular exosome  positive regulation of ERK1 and ERK2 cascade  
Ontology : EGO-EBIphospholipase A2 activity  phospholipase A2 activity  calcium ion binding  phospholipid binding  extracellular region  extracellular space  endoplasmic reticulum  endoplasmic reticulum membrane  phospholipid metabolic process  phosphatidic acid biosynthetic process  positive regulation of macrophage derived foam cell differentiation  lipid catabolic process  secretory granule  low-density lipoprotein particle remodeling  phosphatidylglycerol acyl-chain remodeling  phosphatidylinositol acyl-chain remodeling  phosphatidylserine acyl-chain remodeling  phosphatidylcholine acyl-chain remodeling  phosphatidylethanolamine acyl-chain remodeling  phosphatidic acid metabolic process  calcium-dependent phospholipase A2 activity  perinuclear region of cytoplasm  positive regulation of inflammatory response  defense response to Gram-positive bacterium  extracellular exosome  positive regulation of ERK1 and ERK2 cascade  
Pathways : KEGGGlycerophospholipid metabolism    Ether lipid metabolism    Arachidonic acid metabolism    Linoleic acid metabolism    alpha-Linolenic acid metabolism    Ras signaling pathway    Vascular smooth muscle contraction    Pancreatic secretion    Fat digestion and absorption   
REACTOMEP14555 [protein]
REACTOME Pathways1482788 [pathway]   1482801 [pathway]   1482839 [pathway]   1482922 [pathway]   1482925 [pathway]   1483166 [pathway]   6803157 [pathway]   
NDEx NetworkPLA2G2A
Atlas of Cancer Signalling NetworkPLA2G2A
Wikipedia pathwaysPLA2G2A
Orthology - Evolution
OrthoDB5320
GeneTree (enSembl)ENSG00000188257
Phylogenetic Trees/Animal Genes : TreeFamPLA2G2A
HOVERGENP14555
HOGENOMP14555
Homologs : HomoloGenePLA2G2A
Homology/Alignments : Family Browser (UCSC)PLA2G2A
Gene fusions - Rearrangements
Fusion : MitelmanGNG7/PLA2G2A [19p13.3/1p36.13]  [t(1;19)(p36;p13)]  
Fusion : MitelmanPLA2G2A/FBLN1 [1p36.13/22q13.31]  [t(1;22)(p36;q13)]  
Fusion : MitelmanPLA2G2A/ITGA6 [1p36.13/2q31.1]  [t(1;2)(p36;q31)]  
Fusion : MitelmanPLA2G2A/MBTPS1 [1p36.13/16q23.3]  [t(1;16)(p36;q23)]  
Fusion : MitelmanPLA2G2A/TAF15 [1p36.13/17q12]  [t(1;17)(p36;q12)]  
Fusion : MitelmanTMCO4/PLA2G2A [1p36.13/1p36.13]  [t(1;1)(p36;p36)]  
Fusion: TCGAGNG7 19p13.3 PLA2G2A 1p36.13 SKCM
Fusion: TCGAPLA2G2A 1p36.13 FBLN1 22q13.31 PRAD
Fusion: TCGAPLA2G2A 1p36.13 ITGA6 2q31.1 PRAD
Fusion: TCGAPLA2G2A 1p36.13 MBTPS1 16q23.3 PRAD
Fusion: TCGAPLA2G2A 1p36.13 TAF15 17q12 PRAD
Fusion: TCGATMCO4 1p36.13 PLA2G2A 1p36.13 BRCA
Fusion Cancer (Beijing)PLA2G2A [1p36.13]  -  RPS24 [10q22.3]  [FUSC004537]
Polymorphisms : SNP and Copy number variants
NCBI Variation ViewerPLA2G2A [hg38]
dbSNP Single Nucleotide Polymorphism (NCBI)PLA2G2A
dbVarPLA2G2A
ClinVarPLA2G2A
1000_GenomesPLA2G2A 
Exome Variant ServerPLA2G2A
ExAC (Exome Aggregation Consortium)PLA2G2A (select the gene name)
Genetic variants : HAPMAP5320
Genomic Variants (DGV)PLA2G2A [DGVbeta]
DECIPHER (Syndromes)1:20301924-20306932  ENSG00000188257
CONAN: Copy Number AnalysisPLA2G2A 
Mutations
ICGC Data PortalPLA2G2A 
TCGA Data PortalPLA2G2A 
Broad Tumor PortalPLA2G2A
OASIS PortalPLA2G2A [ Somatic mutations - Copy number]
Somatic Mutations in Cancer : COSMICPLA2G2A  [overview]  [genome browser]  [tissue]  [distribution]  
Mutations and Diseases : HGMDPLA2G2A
LOVD (Leiden Open Variation Database)Whole genome datasets
LOVD (Leiden Open Variation Database)LOVD - Leiden Open Variation Database
LOVD (Leiden Open Variation Database)LOVD 3.0 shared installation
BioMutasearch PLA2G2A
DgiDB (Drug Gene Interaction Database)PLA2G2A
DoCM (Curated mutations)PLA2G2A (select the gene name)
CIViC (Clinical Interpretations of Variants in Cancer)PLA2G2A (select a term)
intoGenPLA2G2A
NCG5 (London)PLA2G2A
Cancer3DPLA2G2A(select the gene name)
Impact of mutations[PolyPhen2] [SIFT Human Coding SNP] [Buck Institute : MutDB] [Mutation Assessor] [Mutanalyser]
Diseases
OMIM172411   
Orphanet
MedgenPLA2G2A
Genetic Testing Registry PLA2G2A
NextProtP14555 [Medical]
TSGene5320
GENETestsPLA2G2A
Huge Navigator PLA2G2A [HugePedia]
snp3D : Map Gene to Disease5320
BioCentury BCIQPLA2G2A
ClinGenPLA2G2A
Clinical trials, drugs, therapy
Chemical/Protein Interactions : CTD5320
Chemical/Pharm GKB GenePA270
Clinical trialPLA2G2A
Miscellaneous
canSAR (ICR)PLA2G2A (select the gene name)
Probes
Litterature
PubMed185 Pubmed reference(s) in Entrez
GeneRIFsGene References Into Functions (Entrez)
CoreMinePLA2G2A
EVEXPLA2G2A
GoPubMedPLA2G2A
iHOPPLA2G2A
REVIEW articlesautomatic search in PubMed
Last year publicationsautomatic search in PubMed

Search in all EBI   NCBI

© Atlas of Genetics and Cytogenetics in Oncology and Haematology
indexed on : Wed Apr 12 11:37:27 CEST 2017

Home   Genes   Leukemias   Solid Tumours   Cancer-Prone   Deep Insight   Case Reports   Journals  Portal   Teaching   

For comments and suggestions or contributions, please contact us

jlhuret@AtlasGeneticsOncology.org.